close all open/close all

CDS information : A4092_00300


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction52,834 / 54,780 / + [in whole cluster]
52,834 / 54,780 / + [in contig]
Location52834..54780 [in whole cluster]
52834..54780 [in contig]
TypeCDS
Length1,947 bp (648 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)putative ABC transporter, Dbv24
Gene
Gene (GenBank)dbv24
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q799B1
NITE
Balhi_00060
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17823795] The ABC transporter Tba of Amycolatopsis balhimycina is required for efficient export of the glycopeptide antibiotic balhimycin. (Appl Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [putative ABC transporter, Dbv24]
MAIVSPFGGLLKGDGEDDPAPSRIRPGTLRRVLGYFRPHVGKVALFVLVTALDSIFVVAS
PLMLKDLVDKGVLGNDLELVILLACLAAGFAVMSTLLQLVSAYISGRIGQGVSYDLRVQA
LDHVQRLPIAFFTRTQTGVLVGRLHTELVMTQMAFTQMLTAAASAVTVLLVLAELFYLSW
IVALLTLVLIPVFLVPWSYVGRRMQRYTRGLMEENAGLAGLLQERFNVQGAMLSKLFGRP
AEEMAEYESRAGRIRGLAVSVTLYGRMAPAIFALMAALATALVYGVGGGLVLSQAFQLGT
LVALATLLGRLFGPITQLASIQENALTVLVSFERIFELLDLKPLIEERPDAVALKAGKAS
DVQFENVSFRYPSADEVSLPSLEQNVRTGQERGEATPEVLRDVSLHVPAGTLTALVGPSG
AGKSTLTHLVSRLYDPTSGTVRVGGHDLRDLTFDSLRETVGVVSQDTYLFHDTIRANLLY
ARPDATEDELVEACRGAQIWDLIASLPRGLDTVVGDRGYRLSGGEKQRLAIARLLLKAPS
VVVLDEATAHLDSESEAAVQRALTTALRSRTSLVIAHRLSTIREADHILVIDDGRVRERG
THEELLAEGGLYADLYHTQFAKSGVNGTRPGQGDGAEPVQEVVGGGER
selected fasta
>putative ABC transporter ATP-binding/permease protein [putative ABC transporter, Dbv24]
ATGGCCATAGTGTCGCCGTTCGGAGGTTTGCTGAAGGGCGACGGAGAGGATGATCCCGCG
CCGTCCAGGATCCGCCCGGGGACGTTGCGACGAGTGCTCGGATACTTCCGCCCGCACGTC
GGCAAGGTGGCGCTCTTCGTTCTCGTCACCGCATTGGATTCGATCTTCGTCGTCGCGTCT
CCGTTGATGTTGAAGGACCTGGTGGACAAGGGGGTTCTGGGGAACGATCTGGAGCTCGTC
ATCCTGCTGGCGTGCCTGGCCGCCGGCTTCGCCGTGATGAGCACGCTGTTGCAGCTCGTG
TCGGCCTACATCTCCGGCCGGATCGGGCAGGGGGTCAGTTACGACCTGCGGGTTCAGGCC
CTTGACCACGTCCAGCGGCTGCCGATCGCGTTCTTCACCCGGACCCAGACGGGCGTGCTG
GTCGGCCGGCTGCACACGGAGCTGGTCATGACGCAGATGGCGTTCACCCAGATGCTGACG
GCCGCCGCCAGCGCGGTCACGGTCCTGCTGGTGCTGGCCGAGCTGTTCTACCTGTCGTGG
ATCGTCGCCCTCCTCACGCTGGTGCTGATCCCGGTGTTCCTGGTGCCCTGGTCTTACGTG
GGACGGCGGATGCAGCGCTACACCAGAGGGCTGATGGAGGAGAACGCCGGCCTGGCCGGG
CTGCTGCAGGAGCGGTTCAACGTCCAGGGGGCGATGCTCTCCAAGCTCTTCGGCCGTCCG
GCCGAGGAGATGGCCGAGTACGAGAGCAGGGCCGGCCGGATCCGCGGGCTCGCCGTGAGC
GTCACCCTCTACGGCCGGATGGCCCCCGCCATCTTCGCGCTGATGGCCGCGCTCGCCACG
GCGCTCGTCTACGGGGTCGGCGGCGGGCTCGTGCTCTCGCAGGCGTTCCAGCTCGGCACG
CTGGTCGCCCTGGCCACCCTGCTCGGGCGGCTGTTCGGGCCGATCACCCAGCTGGCCAGC
ATTCAGGAGAACGCGCTCACGGTCCTGGTGAGCTTCGAGCGGATCTTCGAGCTGCTCGAT
CTGAAGCCGCTGATCGAGGAACGCCCCGACGCGGTCGCGCTCAAGGCCGGCAAGGCCTCG
GACGTCCAGTTCGAGAACGTGTCGTTCCGCTACCCCAGCGCGGACGAGGTCTCGCTGCCG
TCGCTGGAACAGAACGTGCGCACCGGGCAGGAGCGTGGTGAAGCGACGCCGGAGGTGCTG
CGCGACGTGAGCCTGCACGTGCCGGCCGGCACCCTCACCGCGCTCGTGGGCCCGTCCGGC
GCCGGGAAGAGCACCCTCACGCACCTGGTGTCCCGGCTGTACGACCCGACCTCCGGAACC
GTTCGCGTCGGCGGACACGACCTGCGGGACCTCACCTTCGACTCGCTGCGCGAAACGGTG
GGGGTGGTCAGCCAGGACACCTACCTCTTCCATGACACGATTCGGGCGAACCTTCTCTAC
GCCCGCCCCGACGCCACCGAGGACGAGCTGGTCGAGGCGTGCCGAGGGGCGCAGATCTGG
GACCTGATCGCATCCCTGCCACGCGGGCTCGACACCGTCGTGGGTGATCGCGGTTATCGC
CTGTCAGGCGGGGAGAAGCAACGGCTGGCGATCGCCCGGCTGCTGCTGAAGGCACCCTCG
GTCGTCGTTCTCGACGAGGCCACCGCCCACCTGGACTCGGAGTCGGAGGCCGCCGTCCAG
CGGGCACTGACGACAGCCCTGCGCAGCCGTACCTCCCTGGTGATCGCCCACCGGTTGTCC
ACGATCCGCGAGGCCGACCACATTCTCGTGATCGACGACGGGAGGGTCAGGGAGCGCGGG
ACGCACGAGGAGTTGCTGGCGGAAGGCGGTCTCTACGCCGACCTGTACCACACGCAGTTC
GCCAAGTCAGGCGTCAACGGGACCCGGCCGGGACAGGGCGACGGGGCGGAGCCCGTGCAA
GAGGTGGTCGGTGGAGGGGAACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [47-314]  8.59999999999999e-20 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [424-549]  9.29999999999998e-23 PF00005
PF00005   ABC_tran
 [362-618]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [409-595]  1.60000240695997e-17 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [16-343]  2.90000354677981e-61 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [521-535]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [44-327]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [45-64]  Transmembrane (i-o) [79-101]  Transmembrane (o-i) [153-175]  Transmembrane (i-o) [179-201]  Transmembrane (o-i) [270-292]  Transmembrane (i-o)
Transmembrane 5