close all open/close all

CDS information : A4092_00310


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction54,777 / 61,070 / + [in whole cluster]
54,777 / 61,070 / + [in contig]
Location54777..61070 [in whole cluster]
54777..61070 [in contig]
TypeCDS
Length6,294 bp (2,097 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase, modules 1-2
Gene
Gene (GenBank)dbv25
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionPKS/NRPS Module

A1 L-4-hydroxyphenylglycine(Hpg)
2 tyrosine
A37..427
PCP503..571
C602..897
A1064..1454
PCP1530..1599
E1635..2082

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, modules 1-2]
MSAGTRATPTTVLDLFARQVGRAPDAVALVDGDRVLTYRRLDELAGALSGRLIGRGVGRG
DRVAVMMDRSADLVVTLLAVWQAGAAYVPVDAALPARRVAFMVADSGACLMVCSEATRDA
VPQGVESIALTGEGGCGTSAVTVDPGDLAYVMYTSGSTGTPKGVAVPHRSVAELTGNPGW
GVEPGEAVLMHAPYTFDASLFEIWVPLVSGARVVIAAPGAVDARRLREAVAAGVTRVHLT
AGSFRAVAEESPESFAHFREVLTGGDVVPAYAVQKVRAACPHVRIRHLYGPTETTLCATW
QLLEPGDVVGPVLPIGRPLPGRRAWVLDASLRPVEPGVVGDLYLSGAGLADGYLDRAGLT
AERFVADPSAAGRRMYRTGDLAQWTADGELLFAGRADDQVKVRGFRIEPGEVEAALTAQP
HVREAVVVAIDGRLIGYVVADGDVDPVLMRRRLAASLPEYMIPAALVTLDALPLTGSGKV
DRRALPEPDFASAAPRREPGTEPERVLCDLFAELLQPEGRGVGVDDGFVELGGDSIVAIR
LAARASRVGLLVTPAQIFKEKTPARLAAVAGAVPAGRPADGPLITLTAEEEAELATAVPG
AEEVWPLAPLQEGLYFQATLDDEGHDIYQAQWILELAGPLDAARLRASWEAVFARHPELR
VSFHRRASGTMLQVVAGHVVLPWREVDLADAGDIDAAVAALISEEQEQRFDLAKAPLFRL
VLVRHGEDRHRLLVVHHHILTDGWSVAVILNEVAEAYTNGGRLPDRTGAASYRDYLAWLD
RQDKDAARAAWQAELSGLEGPAPIAKAATTTGAGTGYEYRIAFLTPDLHTRLTELARDHG
LTLNTLAQGAWAMVLARLARRTDVVFGTTVACRPAELPEVESVPGLMMNTVPVRVPLQGA
QSVVDLLTGLQERQAALLPHQHLGLTEIQRAAGPGATFDTLLVFENYPRDFAGQFTYLGT
IEGTHYPLTLGIIPGDHFRIQLVYRRGQVGESVAESILGWFTGALMTMAADPHGPVGRIG
VGEARAGGSDRAMAAGEPLPVLLRRVVKDRPDEVAVVDGDGELSFGELWERATALAAELR
AHGIGPESRVAVMVGRSAWWAVGVLGVCLAGGAFMPVDPAYPAERVRWILADSDPRLVLC
AGTTREAVPEEFADRLVVVDELDLAGSDDAGLPRVSPDDAAYVIYTSGSTGTPKGVVVSH
AGLGNLAMAQIDRFAVSPSSRVLQFAALGFDAMVSEMLMALLSGARLVMAPEPALPPRVS
LAEALRRWEVTHVTVPPSVLATADALPAGLETVVVAGEACPPGLAERWSAGRRLVNAYGP
TEATVCAAMSRPLTGSREVVPIGTPIAGGRCYVLDAFLRPLPPGITGELYVAGIGLARGY
LGRASLTAERFVADPFVAGERMYRTGDLAYWTGEGELVFAGRDDDQVKIRGYRVEPGEVE
AVLAGQPGVDQAVVVAREGRLLGYVVSGGGVDPVRLREGVARVLPEYMVPAAVVVLGAVP
VTANGKVDREALPDPGFGGRVSGREPRTEVERALCGLFAEVLGLPGVTAVGPDDSFFELG
GDSITSMQLASRARREGMLFGAREVFERKTPAGLAAIVDVGGELAAGPADGVGEIAWTPI
MRALGDGIVGSRFAQWVVLGAPPDLRADVVAAGLAAVVDTHDVLRLRVVDDRAGRRLAVG
ERGSVDTAGLVTRLECGGRPPDEVVERAVREAVGRLDPVAGVMAQAVWVDAGPARTGRLV
VVVHHLAVDGMSWRILVPDLRLACEAVAEGRDPVLEPVWGSFRRWAALLEESALSRERVG
ELHTWRTIVDQEDRPVGRRRLSAGDAAGGVRSRSWVMSGDEASLLVGKVPVAFHCGVHEV
LLAGLAGAVARWHGDDGVLVDVEGHGRHPAEGMDLSRTVGWFTSMHPVRLDVAGIELAAV
PAGGRAAGQLLKAVKEQSRAAPGDGLGYGLLRHLNPETGPVLAALPSPQIGFNYMGRFVT
VDQGGARPWQPVGGIGGSLDPGMGLPHALEVNAIVHDRLAGPELVLTVDWRDDLLEETDI
ERLCQVWLDMLSGLSRQAEDPSAGGHTASDFALLDLDQDEIEGFEAIAAELSGGQTS
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, modules 1-2]
ATGAGCGCCGGAACGCGGGCCACACCGACGACGGTGCTGGACCTCTTCGCCCGCCAGGTG
GGCCGGGCACCCGATGCGGTGGCTCTGGTCGACGGGGACCGGGTCCTGACCTACCGGCGG
CTGGACGAGCTCGCCGGAGCGCTGTCCGGGCGCCTGATCGGCCGGGGTGTCGGCCGGGGT
GATCGCGTCGCGGTGATGATGGACCGCTCGGCGGACCTGGTGGTGACGCTGCTCGCCGTG
TGGCAGGCGGGGGCGGCCTACGTGCCGGTGGACGCCGCCCTTCCCGCCCGGCGGGTGGCG
TTCATGGTGGCGGACTCCGGAGCCTGCCTGATGGTGTGCTCGGAGGCGACGCGCGATGCG
GTACCGCAAGGGGTCGAGTCGATCGCGTTGACCGGCGAGGGCGGATGCGGCACGTCGGCG
GTCACGGTGGACCCGGGGGATCTGGCGTACGTGATGTACACGTCCGGCTCGACGGGCACC
CCGAAGGGGGTGGCCGTCCCGCATCGGAGCGTCGCGGAGCTGACGGGAAACCCCGGCTGG
GGGGTGGAGCCCGGCGAGGCGGTGCTCATGCACGCGCCCTACACCTTCGACGCCTCCCTG
TTCGAGATCTGGGTGCCGCTCGTGTCGGGCGCCCGGGTGGTGATCGCCGCACCGGGTGCG
GTGGACGCCCGGCGCCTGCGCGAGGCGGTCGCCGCCGGGGTGACGAGGGTGCACCTGACC
GCGGGCAGCTTCCGCGCGGTGGCGGAGGAGTCGCCGGAGTCGTTCGCGCACTTCCGTGAG
GTGCTGACCGGTGGTGACGTGGTGCCCGCGTACGCAGTGCAGAAGGTGCGGGCGGCCTGC
CCTCACGTGCGGATCCGGCATCTGTACGGCCCGACGGAGACGACCCTGTGCGCGACGTGG
CAGCTGCTGGAGCCGGGTGACGTCGTGGGGCCCGTCCTGCCGATCGGCCGCCCGCTGCCG
GGCCGCCGGGCCTGGGTGCTCGACGCGTCATTGCGGCCGGTGGAGCCCGGGGTGGTCGGT
GACCTGTACCTTTCCGGCGCCGGTCTGGCGGACGGCTACCTGGACCGGGCGGGGCTGACG
GCGGAACGGTTCGTGGCGGATCCGTCCGCGGCGGGGAGGCGGATGTATCGGACGGGGGAT
CTGGCTCAGTGGACCGCGGACGGTGAGCTGCTGTTCGCGGGCCGGGCCGACGACCAGGTG
AAGGTCCGCGGATTCCGGATCGAGCCGGGCGAGGTCGAGGCCGCGCTGACCGCTCAGCCG
CACGTCCGCGAGGCCGTGGTGGTGGCGATCGACGGGCGCCTGATCGGTTACGTGGTGGCG
GACGGGGACGTGGATCCCGTACTGATGCGCCGGCGGCTGGCGGCGTCGCTGCCGGAGTAC
ATGATCCCGGCCGCTCTGGTCACGCTGGACGCGTTGCCGCTGACCGGCAGCGGCAAGGTG
GACAGGAGGGCGCTGCCCGAGCCCGATTTCGCGTCGGCCGCGCCGCGCCGCGAACCCGGC
ACCGAGCCGGAGCGCGTCCTGTGCGACCTGTTCGCGGAGCTTCTGCAACCGGAGGGAAGG
GGGGTAGGGGTCGATGACGGTTTCGTCGAGCTGGGCGGGGACTCGATCGTCGCGATCCGG
CTGGCAGCACGTGCGTCCAGGGTGGGGCTGCTGGTGACGCCCGCCCAGATCTTCAAGGAG
AAGACTCCGGCACGGCTGGCAGCCGTCGCGGGTGCCGTACCGGCCGGCAGACCCGCCGAC
GGCCCGCTGATCACCCTCACGGCGGAGGAGGAGGCGGAGCTGGCGACCGCCGTCCCGGGG
GCCGAGGAGGTCTGGCCACTCGCACCGCTCCAGGAAGGGCTCTACTTCCAGGCCACCCTC
GACGACGAGGGTCACGACATCTACCAGGCGCAATGGATCCTGGAGCTGGCGGGGCCGCTG
GACGCCGCCCGGCTGCGGGCCTCGTGGGAAGCGGTCTTCGCCCGGCACCCCGAGCTTCGC
GTGAGCTTCCACCGGCGCGCGTCAGGCACGATGCTGCAGGTCGTCGCCGGGCACGTCGTC
CTGCCGTGGCGAGAGGTGGATCTGGCGGATGCGGGCGATATCGACGCGGCCGTGGCGGCC
CTGATCAGTGAGGAACAGGAGCAGCGGTTCGACCTCGCCAAGGCACCGCTGTTCCGGCTG
GTGCTGGTCCGTCACGGCGAGGACCGGCACCGCCTGCTGGTCGTCCATCACCACATCCTG
ACCGATGGCTGGTCGGTGGCGGTCATCCTCAACGAGGTGGCTGAGGCGTACACGAACGGC
GGCCGTCTCCCGGACCGCACGGGCGCGGCCTCCTACCGGGACTACCTGGCCTGGCTGGAC
CGGCAGGACAAGGACGCCGCACGTGCCGCCTGGCAGGCGGAGCTGTCCGGCCTCGAAGGG
CCCGCGCCGATCGCGAAGGCCGCCACCACGACCGGCGCCGGGACGGGCTACGAATATCGC
ATCGCCTTCCTGACCCCTGACCTCCACACGCGGCTGACGGAGCTGGCCCGCGACCACGGG
CTGACGCTGAACACCCTGGCACAGGGCGCATGGGCGATGGTGCTGGCGCGGCTCGCGCGG
CGCACTGACGTGGTCTTCGGCACCACGGTCGCCTGCCGTCCCGCCGAGCTCCCCGAGGTG
GAGTCGGTGCCGGGTCTCATGATGAACACGGTTCCGGTCCGGGTGCCGCTGCAGGGCGCG
CAATCGGTCGTGGACCTGCTCACCGGCCTGCAGGAACGGCAGGCGGCCTTGCTGCCGCAC
CAGCATCTGGGGCTGACGGAGATCCAGCGGGCGGCAGGACCTGGCGCGACGTTCGACACG
CTGCTGGTCTTCGAGAACTACCCGCGGGACTTCGCCGGCCAGTTCACCTACCTGGGCACG
ATCGAGGGGACCCACTACCCGCTGACCCTCGGCATCATCCCGGGGGATCACTTCAGGATC
CAGCTCGTCTACCGGCGCGGGCAGGTCGGGGAGAGCGTCGCCGAGTCGATCCTGGGATGG
TTCACCGGCGCTCTCATGACGATGGCCGCTGATCCGCACGGGCCGGTGGGCCGGATCGGT
GTGGGTGAGGCCCGGGCCGGCGGCTCGGACCGGGCGATGGCGGCGGGGGAGCCGCTGCCG
GTGCTGCTACGGCGGGTGGTGAAGGACCGGCCGGACGAGGTGGCGGTGGTGGACGGCGAC
GGTGAGCTGTCGTTCGGGGAATTGTGGGAACGGGCGACGGCGCTGGCGGCCGAGCTGAGG
GCTCACGGGATCGGGCCGGAGAGCCGGGTGGCCGTGATGGTGGGCAGGTCGGCGTGGTGG
GCGGTCGGGGTGCTGGGCGTCTGCTTGGCGGGCGGCGCGTTCATGCCGGTGGATCCGGCG
TATCCGGCTGAGCGCGTCAGGTGGATCCTGGCCGACTCCGACCCACGGCTGGTGCTGTGC
GCGGGGACGACGCGGGAGGCGGTGCCGGAGGAGTTCGCAGACCGGCTGGTGGTGGTCGAC
GAGCTGGACCTCGCGGGGAGCGACGATGCGGGCTTGCCACGGGTGAGCCCGGATGACGCG
GCTTATGTGATCTATACGTCGGGATCGACGGGGACTCCCAAGGGGGTCGTCGTCTCGCAC
GCGGGCCTCGGGAATCTGGCGATGGCGCAGATCGACCGGTTCGCCGTGTCGCCGTCGTCG
CGAGTCCTGCAGTTCGCGGCGCTGGGCTTCGACGCGATGGTGTCGGAGATGTTGATGGCG
CTGTTGTCGGGGGCGAGGCTGGTGATGGCGCCGGAGCCGGCCCTGCCACCGCGGGTGTCG
CTGGCCGAGGCGTTGCGGCGGTGGGAGGTCACGCACGTCACGGTTCCGCCGTCGGTGCTG
GCCACCGCCGATGCGCTGCCGGCCGGGCTGGAGACGGTGGTGGTGGCGGGGGAGGCCTGC
CCGCCGGGCCTGGCCGAACGCTGGTCGGCGGGACGGCGGCTGGTCAACGCGTACGGGCCG
ACCGAGGCCACGGTCTGCGCGGCGATGAGCAGGCCGTTGACGGGCAGCCGGGAGGTGGTC
CCGATCGGGACACCCATCGCCGGCGGCCGTTGCTACGTGCTGGACGCGTTCCTGCGGCCG
TTGCCGCCGGGGATCACCGGTGAGCTGTACGTGGCCGGGATCGGGTTGGCGCGCGGCTAT
CTGGGTCGTGCGTCGTTGACGGCTGAGCGGTTCGTGGCGGATCCGTTCGTGGCTGGTGAG
CGGATGTATCGGACGGGGGATCTGGCGTATTGGACGGGTGAGGGCGAGCTGGTGTTCGCC
GGGCGGGATGACGACCAGGTGAAGATCCGTGGGTATCGGGTGGAGCCGGGTGAGGTGGAG
GCGGTGCTGGCGGGGCAGCCGGGGGTGGATCAGGCGGTGGTGGTGGCGCGTGAGGGGCGG
TTGCTGGGTTATGTCGTCTCCGGTGGTGGGGTGGATCCGGTGCGGTTGCGTGAGGGGGTC
GCGCGGGTGTTGCCGGAGTACATGGTGCCGGCGGCGGTGGTGGTGCTGGGTGCGGTGCCG
GTGACGGCGAACGGGAAGGTGGATCGGGAGGCGTTGCCGGATCCGGGCTTCGGCGGGCGG
GTTTCGGGCCGGGAGCCGCGTACGGAGGTCGAGCGGGCGTTGTGCGGGCTCTTCGCCGAG
GTGCTCGGGCTGCCGGGGGTGACGGCGGTGGGGCCGGACGACAGCTTCTTCGAGCTGGGC
GGGGACTCGATCACTTCGATGCAGCTGGCGTCGCGGGCTCGCCGCGAGGGGATGCTCTTC
GGCGCGCGGGAGGTGTTCGAGCGCAAGACGCCTGCGGGGCTCGCGGCGATCGTCGATGTG
GGCGGCGAGCTTGCGGCAGGTCCGGCCGACGGCGTGGGGGAGATCGCGTGGACGCCGATC
ATGCGGGCGCTCGGGGACGGGATCGTGGGGTCGCGGTTCGCCCAGTGGGTGGTGCTGGGT
GCGCCGCCGGACCTACGGGCGGACGTGGTGGCCGCGGGATTGGCGGCGGTGGTGGACACG
CACGACGTGTTGCGGCTGCGGGTCGTCGATGACCGGGCGGGCCGCCGGCTGGCAGTGGGC
GAGCGCGGGTCGGTGGACACGGCCGGGCTGGTCACGCGGCTCGAGTGCGGCGGCCGTCCG
CCGGACGAGGTCGTGGAGCGCGCGGTGCGGGAGGCCGTGGGGCGGTTGGACCCGGTGGCG
GGTGTGATGGCGCAGGCGGTCTGGGTGGATGCGGGGCCGGCGCGGACGGGGCGGTTGGTC
GTCGTGGTGCATCATCTGGCGGTCGACGGGATGTCGTGGCGGATCCTGGTGCCCGACCTG
CGGCTGGCGTGTGAGGCGGTGGCCGAGGGGCGGGATCCGGTGCTGGAGCCGGTGTGGGGG
TCGTTCCGGCGCTGGGCGGCTCTGCTGGAGGAGTCGGCGCTCTCGCGGGAGCGGGTCGGG
GAGCTGCACACGTGGCGGACGATCGTCGATCAGGAGGATCGGCCGGTCGGCCGGCGGCGG
CTGAGCGCAGGGGATGCGGCCGGGGGCGTGCGTTCACGGTCGTGGGTGATGTCGGGGGAT
GAGGCGTCGCTCCTGGTGGGGAAGGTTCCGGTGGCGTTCCACTGCGGGGTCCACGAGGTC
CTGCTGGCGGGCCTGGCGGGAGCGGTGGCGCGCTGGCACGGTGACGACGGGGTCCTGGTG
GATGTGGAAGGCCACGGGCGTCATCCGGCCGAGGGGATGGATCTGTCCAGGACGGTGGGC
TGGTTCACCAGCATGCATCCGGTGCGCCTGGATGTGGCGGGGATCGAGCTGGCGGCGGTG
CCGGCCGGTGGCCGTGCGGCCGGGCAGTTGCTGAAGGCGGTCAAGGAGCAGTCGCGGGCG
GCGCCCGGCGACGGGCTCGGTTACGGGTTGCTGCGCCATCTCAATCCCGAGACGGGCCCC
GTTCTGGCGGCCCTGCCGTCACCGCAGATCGGGTTCAACTACATGGGCCGGTTCGTCACC
GTCGACCAGGGCGGTGCGCGGCCGTGGCAGCCGGTCGGGGGGATCGGCGGTTCGCTGGAC
CCCGGCATGGGCCTGCCGCATGCGCTGGAGGTCAATGCGATCGTCCACGACAGGCTGGCG
GGCCCGGAGCTGGTGCTCACGGTGGACTGGCGGGACGACCTGCTGGAGGAGACCGACATC
GAACGACTGTGCCAGGTGTGGCTGGACATGTTGTCCGGATTGTCCCGCCAAGCGGAGGAT
CCTTCCGCAGGCGGACACACCGCGTCCGACTTCGCCCTACTCGACCTCGACCAGGACGAG
ATCGAGGGCTTCGAAGCCATAGCAGCGGAACTCTCTGGAGGCCAGACATCGTGA
[1] A37..427
[1] L-4-hydroxyphenylglycine(Hpg)197..297
[1] PCP503..571
[2] C602..897
[2] A1064..1454
[2] tyrosine1231..1326
[2] PCP1530..1599
[2] E1635..2082
[1] A109..1281
[1] L-4-hydroxyphenylglycine(Hpg)589..891
[1] PCP1507..1713
[2] C1804..2691
[2] A3190..4362
[2] tyrosine3691..3978
[2] PCP4588..4797
[2] E4903..6246

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [37-427]  1.20000000000001e-103 PF00501 [1064-1454]  3.39999999999996e-112 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [602-897]  3.99999999999998e-62 PF00668 [1635-1912]  3.2e-26 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [530-545]  PS00012 [1558-1573]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [503-571]  PS50075 [1530-1599]  PS50075
PS50075   ACP_DOMAIN
 [493-570]  2.1e-43 G3DSA:1.10.1200.10 [1522-1599]  2.1e-43 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [495-588]  3.00000067992871e-13 SSF47336 [1523-1598]  1.10000150671642e-17 SSF47336
SSF47336   ACP_like
 [506-568]  1.8e-08 PF00550 [1533-1596]  3.8e-11 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1927-2082]  7.4e-36 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [37-427]  1.39999999999997e-123 TIGR01733 [1064-1454]  3.10000000000005e-128 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [151-162]  PS00455 [1183-1194]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit