close all open/close all

CDS information : A4092_00320


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction61,067 / 64,258 / + [in whole cluster]
61,067 / 64,258 / + [in contig]
Location61067..64258 [in whole cluster]
61067..64258 [in contig]
TypeCDS
Length3,192 bp (1,063 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase, module 3
Gene
Gene (GenBank)dbv26
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionPKS/NRPS Module

A3 L-3,5-dihydroxyphenylglycine(Dpg)
C13..308
A487..877
PCP953..1022

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, module 3]
MNTPSTPAGSALEEVWPLSPMQEGILYHAALDEAPDLYLIQQSQIIEGPLDTERFRLAWE
SLLNRHAALRACFHRRKSGESVQLIPRKVPLPWSERDLSGLSEEDALAEASVIAEKERAT
RFDPAKPPLLRQVLIRFGPDKHCLVTTSHHLVMDGWSRAILESELLELYAAGGAEPGLRP
AGSYRDYLAWLERQDKEAARAAWRAELAGADRSTLGIPEASRKTQGQRVREVLGYAPDFT
SALVDFARRHGLTLNTLVQGAWALVLARLTRRRDVVFGAVVSGRPAEVPGVEQAVGLFIN
TVPVRVRLDGGQPVIQLLTELQERQSTLISHQHLGLQEIQKLSGVSFDTVVSFENYVDPG
AGPGSDRELRLRLKEFHQSAPYALLLGIMPGESLQTDVEYRPELLDARVAKEALHGLARV
LERMIAEPETAVGRLDVVGDAGRELVVERWNETGDAIGAPSAVDLFRRQVARAPAATAVT
AGDLAWSYAELDERSGRLARALTERGVRRGDRVGVVLGRSAEVLAAWLGVWKAGAAFVPV
DPDYPADRVAFMLADSAVAMVVCQEATSGVVPPGYQQLLVNDADDGEAALVPIGADDLAY
VMYTSGSTGTPKGVAIPHGGVAALAGDPGWGVGPGDAVLMHAPHTFDASLYDVWVPLVSG
ARVMITEPGVVDAERLAGHVADGLTAVNFTAGHFRALAQESPESFSGLREVAAGGDVVPL
DVVERVRRACPRLRVWHTYGPTETTLCATWKAIEPGDEVGPVLPIGRALPGRRLYVLDAF
LRPLPPGIAGDLYLAGAGVAHGYLGRASLTAERFVADPFVAGERMYRTGDLAYWTGEGEL
VFAGRDDDQVKIRGYRVEPGEVEAVLAGQPGVDQAVVVAREGRLLGYVVSGGGVDPVRLR
EGVARVLPEYMVPAAVVVLGAVPVTANGKVDREALPDPGFGGRVSGREPRTEVERALCGL
FAEVLGLPGVTAVGPDDSFFELGGDSIHSVKLAARATRAGMPFTVVEVFEHKTPAGLATI
VDVGGEPAAGPADPPSDSDLLGLAQDEIAEFEAEFDDERHSLR
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, module 3]
GTGAACACGCCGAGCACACCCGCCGGATCGGCGCTTGAGGAAGTCTGGCCGCTGTCACCG
ATGCAGGAGGGGATCCTCTATCACGCCGCACTCGATGAGGCCCCTGACCTCTACCTCATC
CAGCAGTCGCAGATCATCGAAGGACCCTTGGACACCGAGCGGTTCCGCCTGGCTTGGGAG
AGCCTCCTCAACCGGCATGCGGCGCTTCGCGCGTGCTTCCACCGGCGGAAGTCCGGTGAG
TCGGTCCAGCTCATCCCCCGTAAGGTGCCGCTCCCGTGGTCCGAGCGCGACCTGTCCGGC
CTGTCCGAGGAGGACGCGCTGGCCGAGGCGAGCGTGATCGCGGAGAAGGAGCGCGCCACG
AGATTCGACCCGGCCAAGCCTCCGCTGCTGCGGCAGGTGCTGATCCGGTTCGGTCCGGAC
AAGCACTGTCTGGTGACGACGAGCCATCACCTGGTCATGGACGGGTGGTCGCGGGCGATC
CTCGAGTCGGAGCTCCTCGAGCTCTACGCCGCGGGTGGCGCCGAGCCGGGGCTGCGGCCC
GCCGGCTCCTACCGGGACTATCTGGCCTGGCTGGAGCGGCAGGACAAGGAGGCCGCCCGC
GCGGCATGGCGTGCGGAGCTGGCGGGCGCCGACCGTTCGACACTCGGCATCCCCGAAGCG
TCCAGGAAGACCCAGGGGCAGCGGGTGCGGGAGGTGCTCGGCTACGCGCCGGACTTCACC
TCCGCTCTGGTGGACTTCGCCCGCCGCCATGGGCTGACGCTGAACACGCTGGTGCAGGGG
GCGTGGGCGTTGGTGCTGGCCCGGCTCACGCGCCGTCGTGACGTGGTGTTCGGCGCGGTG
GTCTCGGGACGTCCGGCGGAGGTGCCCGGCGTGGAGCAGGCCGTCGGGCTGTTCATCAAC
ACCGTGCCGGTGCGCGTCCGGTTGGACGGCGGGCAGCCGGTCATCCAGCTGCTGACGGAG
CTGCAGGAGCGGCAGTCCACGCTCATCTCGCATCAGCATCTCGGGCTGCAGGAGATCCAG
AAGCTCTCCGGGGTGAGCTTCGACACCGTCGTGTCGTTCGAGAACTACGTCGATCCGGGG
GCGGGTCCGGGCTCCGATCGCGAGCTGCGCCTGAGACTGAAGGAGTTTCACCAGTCGGCG
CCGTACGCGCTCCTCCTCGGCATCATGCCAGGTGAGAGCCTCCAGACCGACGTGGAGTAC
CGGCCCGAGCTGCTCGACGCCCGCGTCGCCAAGGAGGCCCTCCACGGGCTCGCCCGCGTC
CTCGAGCGGATGATCGCCGAGCCGGAGACCGCAGTGGGCCGCCTGGACGTGGTCGGTGAC
GCGGGGCGCGAGCTGGTGGTCGAGCGGTGGAACGAGACGGGCGACGCGATCGGTGCGCCG
TCCGCGGTGGACCTGTTCCGGCGCCAGGTTGCACGGGCACCCGCCGCGACGGCGGTGACG
GCCGGGGACCTGGCCTGGTCGTACGCGGAGCTCGACGAGCGGTCCGGCCGGCTGGCGCGG
GCACTGACGGAACGCGGCGTGCGACGCGGCGACCGGGTGGGCGTGGTGCTGGGGCGGTCG
GCAGAGGTGCTGGCAGCCTGGCTCGGAGTGTGGAAGGCAGGCGCGGCGTTCGTGCCGGTC
GACCCGGACTACCCGGCGGACCGGGTGGCGTTCATGCTGGCCGACTCCGCCGTCGCGATG
GTGGTGTGCCAGGAGGCGACCTCGGGTGTGGTGCCCCCGGGCTACCAGCAGCTCCTGGTG
AACGACGCCGACGACGGCGAGGCCGCCCTGGTCCCGATCGGGGCGGACGATCTCGCCTAC
GTGATGTACACCTCCGGATCGACCGGGACCCCGAAGGGCGTGGCGATCCCGCACGGCGGC
GTGGCGGCGCTGGCGGGAGATCCGGGATGGGGCGTCGGACCCGGCGACGCGGTGCTGATG
CACGCCCCGCACACCTTCGACGCGTCGTTGTACGACGTGTGGGTGCCGCTCGTCTCCGGC
GCGCGGGTCATGATCACCGAGCCGGGGGTCGTCGACGCGGAGCGGCTCGCCGGGCATGTG
GCCGACGGCCTCACCGCGGTCAACTTCACCGCGGGGCACTTCCGCGCGCTGGCGCAGGAG
TCGCCGGAGTCGTTCTCCGGGCTGCGCGAGGTGGCGGCGGGTGGCGACGTGGTGCCGCTC
GATGTGGTGGAGCGGGTACGGCGGGCGTGCCCGCGGCTCCGGGTCTGGCACACCTACGGC
CCGACCGAGACCACGCTGTGCGCGACGTGGAAGGCGATCGAGCCCGGTGACGAGGTGGGG
CCGGTGCTGCCCATCGGCCGGGCACTGCCGGGCCGGCGGCTGTACGTGCTGGACGCGTTC
CTGCGGCCGTTGCCGCCGGGCATCGCGGGTGATCTCTACCTCGCAGGCGCCGGAGTGGCC
CACGGCTATCTGGGTCGTGCGTCGTTGACGGCTGAGCGGTTCGTGGCGGATCCGTTCGTG
GCTGGTGAGCGGATGTATCGGACGGGGGATCTGGCGTATTGGACGGGTGAGGGCGAGCTG
GTGTTCGCCGGGCGGGATGACGACCAGGTGAAGATCCGTGGGTATCGGGTGGAGCCGGGT
GAGGTGGAGGCGGTGCTGGCGGGGCAGCCGGGGGTGGATCAGGCGGTGGTGGTGGCGCGT
GAGGGGCGGTTGCTGGGTTATGTCGTCTCCGGTGGTGGGGTGGATCCGGTGCGGTTGCGT
GAGGGGGTCGCGCGGGTGTTGCCGGAGTACATGGTGCCGGCGGCGGTGGTGGTGCTGGGT
GCGGTGCCGGTGACGGCGAACGGGAAGGTGGATCGGGAGGCGTTGCCGGATCCGGGCTTC
GGCGGGCGGGTTTCGGGCCGGGAGCCGCGTACGGAGGTCGAGCGGGCGTTGTGCGGGCTC
TTCGCCGAGGTGCTCGGGCTGCCGGGGGTGACGGCGGTGGGGCCGGACGACAGCTTCTTC
GAGCTGGGCGGGGACTCCATCCATTCGGTGAAGCTGGCAGCGCGGGCCACGCGTGCCGGC
ATGCCCTTCACCGTGGTCGAGGTGTTCGAGCACAAGACGCCTGCGGGGCTCGCGACGATC
GTCGACGTGGGCGGCGAGCCCGCGGCAGGTCCGGCTGATCCCCCATCGGACTCCGACCTG
CTCGGCCTGGCGCAGGACGAGATAGCGGAGTTCGAGGCCGAATTCGACGACGAACGTCAT
TCTCTGCGCTGA
[3] C13..308
[3] A487..877
[3] L-3,5-dihydroxyphenylglycine(Dpg)647..747
[3] PCP953..1022
[3] C37..924
[3] A1459..2631
[3] L-3,5-dihydroxyphenylglycine(Dpg)1939..2241
[3] PCP2857..3066

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [487-877]  1.60000000000002e-107 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [13-308]  9.9e-61 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [981-996]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [953-1022]  PS50075
PS50075   ACP_DOMAIN
 [946-1021]  1.10000150671642e-17 SSF47336
SSF47336   ACP_like
 [945-1022]  2.7e-23 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [956-1019]  1.4e-11 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [487-877]  1.69999999999998e-124 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020459 AMP-binding (Domain)
 [596-607]  9.20000434662057e-05 PR00154 [608-616]  9.20000434662057e-05 PR00154
PR00154   AMPBINDING
IPR020845 AMP-binding, conserved site (Conserved_site)
 [601-612]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit