close all open/close all

CDS information : A4092_00330


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction64,354 / 65,187 / + [in whole cluster]
64,354 / 65,187 / + [in contig]
Location64354..65187 [in whole cluster]
64354..65187 [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative SAM-dependent N-methyltransferase
Product (GenBank)putative methyltransferase
Gene
Gene (GenBank)dbv27
EC number2.1.1.-
Keyword
  • Hpg1
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52805
NITE
Chlor_00170
PmId
[19389626] Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. (Chem Biol. , 2009)
ACC
R4T056
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative SAM-dependent N-methyltransferase [putative methyltransferase]
MISKAMHGPIRPARADTLLASVGERGILCDFYDENASEIFRDLEADAGGTEEAHGFAALV
RPESGAILELGAGTGRLTIPLLELGWEVTALELSTAMLTTLRTRLADAPADLRDRCTLVH
ADMTAFKLGERFGTAILSPSTIDLLDDADRPGLYSSVREHLRPGGRFLLGMANPDASGRQ
EPLERTQEFTGRSGRRYVLHAKVYPSEEIRDVTIHPADESADPFVICVNRFRVITPDQIA
RELEQAGFDVVARTPLPGVRNHELVLEAQWGSVEDAH
selected fasta
>putative SAM-dependent N-methyltransferase [putative methyltransferase]
ATGATAAGCAAAGCAATGCATGGACCGATTCGGCCCGCCCGCGCGGATACCCTGCTGGCC
TCGGTAGGCGAGCGAGGCATTCTGTGTGACTTTTACGACGAGAACGCCTCGGAAATCTTC
CGTGATTTGGAGGCGGACGCGGGCGGCACGGAAGAAGCCCACGGGTTCGCGGCGCTCGTC
CGCCCGGAGTCGGGGGCGATCCTGGAGCTCGGGGCCGGAACAGGCAGGCTGACGATTCCG
CTCCTGGAGCTCGGCTGGGAGGTGACCGCCCTCGAACTGTCGACCGCGATGCTCACCACC
CTGCGGACGCGGCTGGCGGACGCGCCGGCGGACCTCCGGGATCGGTGCACCCTCGTTCAC
GCGGACATGACCGCCTTCAAACTGGGAGAACGCTTCGGAACGGCGATTCTCAGCCCGTCC
ACGATCGACCTCCTGGACGATGCCGACAGACCAGGGCTGTACTCGTCGGTCCGTGAGCAT
CTGCGGCCCGGCGGGAGATTCCTGCTCGGCATGGCCAACCCCGACGCGTCCGGCAGGCAG
GAGCCGCTGGAGCGCACCCAGGAGTTCACGGGCAGGAGCGGCCGCCGATACGTGCTGCAC
GCCAAGGTCTACCCGTCGGAGGAGATCCGCGACGTGACCATTCATCCTGCGGATGAATCG
GCGGACCCCTTCGTCATCTGCGTCAATCGCTTCAGAGTCATCACCCCGGATCAGATAGCA
CGAGAGCTGGAGCAAGCCGGATTCGACGTGGTCGCGCGGACCCCACTGCCCGGGGTGCGT
AATCACGAACTGGTGCTGGAAGCGCAATGGGGCAGCGTGGAAGACGCGCATTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit