close all open/close all

CDS information : A4092_00340


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction65,248 / 66,843 / + [in whole cluster]
65,248 / 66,843 / + [in contig]
Location65248..66843 [in whole cluster]
65248..66843 [in contig]
TypeCDS
Length1,596 bp (531 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)putative beta-hydroxylase
Gene
Gene (GenBank)dbv28
EC number
Keyword
  • Bht
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[16499611] A derivative of the glycopeptide A40926 produced by inactivation of the beta-hydroxylase gene in Nonomuraea sp. ATCC39727. (FEMS Microbiol Lett. , 2006)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionSequence

selected fasta
>putative hydroxylase [putative beta-hydroxylase]
MSEELLFLRPDTIIEPLANRFYASMYATAPVTAAMNLAFRNLPMLESYLASPEWHFAAAR
DPKFRGGFFVNIEEQRKNEVEALLAAIRRDSADVLRFAEAIAEAEKIIREEATGYDLRPL
YPKLPPELSGLVEIAYDTGNAASLHFLEPLIYKSKAYAEDCQSVQLSVETGIERPFVMST
PRLPSPDVLELNIPFRHPGLEELFLSRIRPTTLAALREALELGDAEAARLADLLVPEPSL
ASDRHVAAGARIRYWGHACLLMQTPDVAIMTDPFISADTDATGRYTYNDLPDRLDYVLIT
HGHSDHLVPETLLQLRGRVGTFVVPRTSRGNLCDPSLALYLRSFGLPAIEVDDFDEIEFP
GGKIVSTPFFGEHADLDIRAKSTYWINLGGKSIWVGADSSGLDPVLYRHIRRHLGAVNIA
FLGMECDGAPLNWQYQPFITKALPKKMSDSRKMSGSNAEQAGAIVTELGAEEAYIYAMGE
ESWLGHVMATSYNEDSYQLQQIAEFEAWCSRKGVKAAHLLDQHEWHWSSSR
selected fasta
>putative hydroxylase [putative beta-hydroxylase]
ATGAGTGAGGAGCTCCTCTTCCTCCGGCCCGACACCATTATCGAACCGCTGGCCAACCGG
TTCTACGCCTCGATGTACGCGACGGCTCCCGTCACGGCCGCCATGAATCTCGCCTTCCGT
AACCTGCCGATGCTGGAGTCCTACCTCGCATCCCCGGAATGGCATTTCGCAGCCGCTCGC
GATCCGAAGTTCCGCGGCGGATTCTTCGTCAACATCGAGGAGCAGCGGAAGAACGAGGTC
GAGGCGCTGCTCGCTGCGATCCGGCGCGACAGCGCGGACGTGCTCCGGTTCGCCGAGGCG
ATCGCGGAGGCCGAGAAGATCATCCGCGAGGAAGCGACCGGATACGATCTCAGGCCGCTC
TACCCGAAGCTGCCTCCCGAGCTGTCGGGTCTGGTGGAGATCGCCTATGACACCGGCAAC
GCGGCCTCGCTGCACTTCCTGGAGCCGCTCATCTACAAGAGCAAGGCCTACGCCGAGGAC
TGCCAGTCCGTTCAGCTCTCCGTGGAGACCGGGATCGAGCGGCCGTTCGTGATGAGCACC
CCGCGACTGCCCTCACCCGACGTGCTCGAGCTGAACATCCCGTTCCGGCATCCGGGTCTG
GAGGAGCTCTTCCTGTCCAGGATCCGGCCCACCACCCTGGCCGCCCTCCGCGAGGCGCTG
GAGCTCGGCGACGCGGAAGCGGCGCGGCTCGCCGACCTGCTGGTCCCGGAGCCCTCGCTC
GCCTCCGACCGCCATGTCGCGGCCGGAGCCCGGATCCGCTACTGGGGGCACGCCTGCCTG
CTCATGCAGACGCCCGACGTGGCCATCATGACGGACCCGTTCATCAGCGCGGATACCGAC
GCGACCGGCCGCTACACCTACAACGACCTGCCTGACCGCCTCGACTACGTCCTCATCACG
CACGGGCATTCCGACCATCTGGTGCCCGAGACGCTGCTTCAACTGCGCGGCCGGGTGGGC
ACGTTCGTCGTGCCGCGAACCTCGCGCGGCAACCTGTGCGATCCTTCGCTGGCGCTCTAT
CTCAGAAGCTTCGGGCTGCCCGCGATCGAGGTGGACGATTTCGATGAGATCGAGTTCCCC
GGCGGGAAGATCGTCTCCACCCCGTTCTTCGGCGAGCACGCCGATCTCGACATCCGGGCC
AAGTCGACGTATTGGATCAACCTCGGTGGCAAGTCGATCTGGGTGGGCGCGGACTCCTCA
GGCCTCGATCCGGTTCTCTACCGCCATATCCGCCGGCATCTCGGCGCGGTCAACATCGCC
TTCCTCGGGATGGAATGCGATGGCGCGCCGCTGAACTGGCAGTACCAGCCGTTCATCACC
AAGGCGTTGCCGAAGAAGATGAGCGACAGCCGCAAGATGTCCGGCTCCAACGCGGAGCAG
GCAGGTGCGATCGTCACCGAGCTGGGCGCCGAGGAGGCGTACATCTACGCCATGGGGGAG
GAGAGCTGGCTGGGGCATGTCATGGCCACCAGCTACAACGAGGACTCCTACCAGCTCCAG
CAGATCGCCGAGTTCGAGGCATGGTGTTCCCGCAAGGGTGTGAAGGCCGCTCATCTGCTC
GACCAGCATGAGTGGCACTGGTCGTCATCCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [255-306]  2.2e-05 PF00753
PF00753   Lactamase_B
IPR019204 Domain of unknown function DUF2070, membrane (Domain)
 [312-490]  5.10000000000004e-35 PF09843
PF09843   DUF2070
SignalP No significant hit
TMHMM No significant hit