close all open/close all

CDS information : A4092_00360


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction69,089 / 69,514 / + [in whole cluster]
69,089 / 69,514 / + [in contig]
Location69089..69514 [in whole cluster]
69089..69514 [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Dbv30 protein
Gene
Gene (GenBank)dbv30
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionSequence

selected fasta
>hypothetical protein [Dbv30 protein]
MTSTSGRHLYHRQVRFSDIDAHGHVNNVRFLEYLEDAWIALYLDNAGPPQEDRDGLPAVG
FAVVRHEIFYRRPLRFRHGSVRVESWVTKVNRVTCEMAAQICSDGEVFVEARSMIMGFDT
HTAKPRRLTLHERTFLKRYLR
selected fasta
>hypothetical protein [Dbv30 protein]
ATGACGAGCACCTCCGGGCGGCACCTGTATCACCGCCAGGTGCGATTCTCCGATATCGAC
GCCCACGGCCACGTCAACAATGTGCGTTTCCTGGAATACCTGGAGGACGCCTGGATCGCC
CTCTATCTCGACAATGCGGGCCCGCCGCAGGAGGACCGCGACGGATTGCCCGCCGTGGGG
TTCGCCGTCGTGCGCCACGAGATCTTCTATCGGCGCCCGCTCAGGTTCCGGCACGGGTCG
GTGCGGGTCGAGTCGTGGGTGACCAAGGTGAACAGGGTGACCTGCGAGATGGCCGCGCAG
ATCTGCTCGGACGGGGAGGTGTTCGTCGAAGCCCGCTCGATGATCATGGGGTTCGACACG
CACACCGCCAAGCCGCGGCGCCTCACCCTGCACGAGCGCACCTTTCTCAAGCGTTACCTG
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit