close all open/close all

CDS information : A4092_00370


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction69,671 / 70,789 / + [in whole cluster]
69,671 / 70,789 / + [in contig]
Location69671..70789 [in whole cluster]
69671..70789 [in contig]
TypeCDS
Length1,119 bp (372 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative DpgA protein
Genedbv31
dpgA
Gene (GenBank)dbv31
EC number
Keyword
  • type III PKS
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q939X3
NITE
Balhi_00320
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
ACC
O52795
NITE
Chlor_00280
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[12240210] Biosynthesis of the vancomycin group of antibiotics: characterisation of a type III polyketide synthase in the pathway to (S)-3,5-dihydroxyphenylglycine. (Chem Commun (Camb). , 2001)
[14744141] Role of the active site cysteine of DpgA, a bacterial type III polyketide synthase. (Biochemistry. , 2004)
[22492619] Chain elongation and cyclization in type III PKS DpgA. (Chembiochem. , 2012)

close this sectionPKS/NRPS Module

B1
CHS98..370

close this sectionSequence

selected fasta
>polyketide synthase [putative DpgA protein]
MGVDVSMTTSIASAEDLSVLTGLSEITTFAGVGTAVSATSYSQAELLEILDIRDPRIRSL
FLNSAIERRFLALPPQGRDGERVAEPQGDLLDKHKKLAVDMGCRALESCLKSAGATLSDV
RHLCCVTSTGFLTPGLSALIIRELGLDPHCSRADIVGMGCNAGLNALNLVAGWSAAHPGE
LAVVLCSEACSAAYALDGTMRTAVVNSLFGDGSAALAVVSGDGRAAGPRVLKFASYVITD
AIEAMRYDWDRDQDRFSFFLDPQIPYVVGAHAEIVVDKLLSGTGLRRSDIGHWLVHSGGK
KVIDAIVVNLGLSRHDVRHTTAVLRDYGNLSSGSFLFSYERLAGEGVTRPGDYGVLMTMG
PGSTIETALIQW
selected fasta
>polyketide synthase [putative DpgA protein]
ATGGGGGTGGATGTATCGATGACGACCAGCATCGCGTCGGCAGAAGACCTTTCCGTCCTC
ACCGGACTGAGCGAGATCACCACGTTCGCCGGCGTGGGGACAGCCGTTTCCGCCACGTCC
TATTCGCAAGCCGAGCTGCTCGAAATCCTCGACATACGCGATCCCAGGATCCGATCGCTG
TTCCTGAACAGCGCGATCGAGCGGCGTTTTCTCGCGCTTCCGCCCCAGGGCCGGGACGGG
GAGCGCGTGGCGGAACCGCAGGGTGATCTCCTGGACAAGCACAAAAAGCTCGCCGTCGAT
ATGGGATGCCGGGCCCTCGAGTCCTGCCTGAAGTCGGCGGGCGCGACGCTCTCGGATGTC
CGCCACCTGTGCTGCGTCACCTCGACCGGTTTTCTCACCCCCGGCCTGAGCGCACTCATC
ATCCGCGAGCTCGGGCTCGACCCGCATTGCAGCCGCGCCGACATCGTCGGCATGGGATGC
AACGCGGGGCTGAACGCGCTCAACCTGGTCGCGGGCTGGTCCGCGGCGCACCCGGGCGAG
CTCGCCGTCGTTCTGTGCAGCGAGGCGTGTTCCGCTGCTTACGCACTGGACGGCACCATG
CGCACCGCGGTGGTCAACAGCCTGTTCGGCGACGGATCCGCCGCCCTCGCCGTCGTCTCC
GGTGACGGGCGCGCTGCCGGCCCGCGCGTCCTGAAGTTCGCGAGCTACGTCATCACCGAC
GCGATCGAGGCGATGCGCTACGACTGGGACCGCGACCAGGACCGGTTCAGCTTCTTCCTC
GATCCGCAGATCCCCTACGTGGTCGGCGCGCACGCCGAGATCGTCGTCGACAAGCTGCTG
TCCGGTACGGGGCTGCGCCGCAGCGACATCGGCCATTGGCTGGTGCACTCCGGCGGCAAG
AAGGTGATCGACGCCATCGTCGTCAACCTCGGCCTGAGCCGGCATGACGTCCGCCACACG
ACCGCTGTGCTCCGCGACTACGGGAACCTCTCCAGCGGCTCCTTCCTCTTCTCCTACGAA
CGGCTCGCCGGCGAGGGCGTGACCAGGCCCGGAGACTACGGGGTGCTCATGACCATGGGG
CCCGGCTCCACGATCGAAACGGCGCTGATCCAATGGTGA
[1] CHS98..370
[1] CHS292..1110

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001099 Chalcone/stilbene synthase, N-terminal (Domain)
 [98-219]  1.1e-15 PF00195
PF00195   Chal_sti_synt_N
IPR011141 Polyketide synthase, type III (Family)
 [1-372]  PIRSF000451
PIRSF000451   PKS_III
IPR012328 Chalcone/stilbene synthase, C-terminal (Domain)
 [257-370]  4.00000000000001e-15 PF02797
PF02797   Chal_sti_synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [28-224]  8.00000000000001e-44 G3DSA:3.40.47.10 [230-372]  3.80000000000003e-34 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [80-372]  1.70000295590053e-45 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit