close all open/close all

CDS information : A4092_00380


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction70,801 / 71,442 / + [in whole cluster]
70,801 / 71,442 / + [in contig]
Location70801..71442 [in whole cluster]
70801..71442 [in contig]
TypeCDS
Length642 bp (213 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)putative DpgB protein
Genedbv32
dpgB
Gene (GenBank)dbv32
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52796
NITE
Chlor_00290
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [putative DpgB protein]
MNGELELSLDGTQALTASVEELNGLCDRAEDHRAPGPVIVHVTGVPRLGWSKGLTVGLVS
KWERVVRRFERLGRLTVAVASGDCAGPSLDLLLAADVRIAAPATRLLPSWAGGAAWPGMA
VYRLTQQAGTGGIRRAVLLGAPIDADRALALNLIDEVSADPAASLAGLAGAGDGAELAIR
RQLMFEASSTTFEDALGAHLAAVDRALRRETLS
selected fasta
>putative enoyl-CoA hydratase [putative DpgB protein]
ATGAACGGCGAACTGGAGCTGAGCCTCGACGGCACCCAGGCGCTGACCGCGTCGGTCGAG
GAGCTGAACGGCCTCTGCGACCGCGCCGAGGACCATCGAGCACCCGGCCCGGTCATCGTC
CACGTCACCGGCGTGCCGCGCCTTGGCTGGTCGAAGGGGCTGACGGTGGGCCTGGTCTCC
AAGTGGGAGCGGGTGGTGCGCCGGTTCGAACGGCTCGGCCGGCTCACCGTCGCCGTGGCG
TCAGGCGACTGCGCGGGACCCTCTCTCGACCTCCTCCTCGCTGCCGACGTGCGGATCGCC
GCTCCGGCGACCCGGCTGCTGCCCTCCTGGGCCGGCGGCGCCGCGTGGCCGGGGATGGCC
GTCTACCGGCTCACCCAGCAGGCCGGTACGGGCGGCATCCGGCGGGCCGTGCTGCTCGGG
GCACCCATCGACGCCGACCGCGCGCTCGCCCTCAACCTGATCGACGAGGTGTCCGCGGAC
CCGGCGGCGTCCCTGGCCGGCCTGGCGGGTGCCGGGGACGGCGCGGAGCTGGCGATTCGC
AGGCAGCTGATGTTCGAGGCGAGCTCAACCACTTTCGAGGACGCGCTCGGTGCTCACCTG
GCCGCGGTGGACCGGGCCCTACGACGGGAGACCCTCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [61-159]  1.2e-08 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit