close all open/close all

CDS information : A4092_00390


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction71,439 / 72,743 / + [in whole cluster]
71,439 / 72,743 / + [in contig]
Location71439..72743 [in whole cluster]
71439..72743 [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase
Product (GenBank)putative DpgC protein
Genedbv33
dpgC
Gene (GenBank)dbv33
EC number
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52812
NITE
Chlor_00300
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[15380180] DpgC is a metal- and cofactor-free 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase in the vancomycin biosynthetic pathway. (Chem Biol. , 2004)

close this sectionSequence

selected fasta
>putative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [putative DpgC protein]
MTTDWPALPPRAPLALWTLTAEAQRVDDLLAGLPEPPARTSAQRDAAASALDKVRRMRAD
YMEAHAEEIYGELTSGRTRHLRIDELVRAAARAYPGLVPTDEQMAAERARPQAEKEGREI
DQGIFLRGVLRAPKAGPHLLDAMLRPTPRALELLPEFIESGEVRMEAVLLRRRDGVAYLT
LCRDDCLNAEDAQQVDDMETAVDLALLDPQVRVGLLRGGEMSHPRYRGRRVFCAGVNLKK
LSSGDISLVDFLLRRELGYIHKIVRGVYTDGSWHSKLTDKPWMAVVDSFAIGGGAQLLLV
FDQVLAASDSYISLPAATEGIIPGVANYRLTRFTGPRAARQMILGGRRIRADEPDARLMI
DEVVPPEEMDAAIDRALARLDGDAVPANRRMLNLAEEPPEAFGRYLAEFALQQALRIYGR
DVIGKVGRFAAGSA
selected fasta
>putative 3,5-dihydroxyphenylacetyl-CoA 1,2-dioxygenase [putative DpgC protein]
GTGACGACGGATTGGCCGGCGCTGCCGCCCAGGGCGCCGCTCGCCCTCTGGACCCTGACG
GCGGAGGCCCAGCGAGTCGACGACCTGCTCGCCGGGCTGCCGGAGCCTCCTGCCAGAACC
TCCGCCCAGCGCGATGCCGCGGCCTCGGCACTCGACAAGGTGAGGCGGATGCGCGCGGAC
TACATGGAGGCGCACGCCGAGGAGATCTACGGCGAGCTCACCTCCGGCCGCACCCGGCAC
CTGCGCATCGACGAGCTCGTACGGGCCGCCGCCCGCGCCTACCCCGGCCTGGTGCCCACC
GATGAGCAGATGGCGGCCGAGCGCGCGCGGCCACAGGCGGAGAAGGAAGGGCGCGAGATC
GATCAGGGCATCTTCCTGCGCGGGGTCCTGCGTGCCCCGAAGGCGGGCCCGCACCTGCTC
GACGCCATGCTCCGGCCCACCCCCAGGGCCCTTGAGCTGCTCCCTGAATTCATCGAGTCC
GGCGAGGTGCGGATGGAGGCGGTCCTGCTGCGGCGCCGTGACGGTGTCGCGTACCTGACC
CTGTGCCGGGACGACTGCCTCAACGCCGAGGACGCGCAGCAGGTGGACGACATGGAGACC
GCAGTCGACCTGGCGCTGCTCGACCCCCAGGTCCGGGTGGGGCTCCTGCGGGGCGGCGAG
ATGAGCCATCCCCGGTACCGGGGGCGCCGGGTGTTCTGCGCGGGCGTCAACCTCAAGAAG
CTGAGCTCGGGCGACATCTCCCTCGTCGACTTCCTCCTACGGCGCGAGCTGGGCTACATC
CACAAGATCGTTCGCGGCGTGTACACGGACGGTTCGTGGCACTCGAAGCTGACCGACAAG
CCCTGGATGGCGGTCGTCGACTCCTTCGCCATCGGCGGTGGGGCTCAGCTCCTCCTGGTC
TTCGACCAGGTGCTGGCGGCGTCCGACTCCTACATCAGCCTGCCTGCGGCGACGGAGGGG
ATCATTCCGGGGGTCGCGAACTACCGGCTCACCCGGTTCACCGGGCCACGCGCGGCCCGG
CAGATGATCCTCGGCGGGCGGCGGATCCGGGCGGACGAGCCGGACGCACGGTTGATGATC
GACGAGGTCGTCCCGCCGGAGGAGATGGACGCGGCGATCGATCGCGCACTGGCCCGCCTC
GACGGAGATGCGGTGCCGGCCAACCGGCGCATGCTGAACCTGGCCGAGGAGCCGCCCGAG
GCGTTCGGCCGGTACCTGGCCGAGTTCGCCCTGCAGCAGGCACTGCGCATCTACGGCAGG
GACGTCATCGGCAAGGTCGGCAGGTTCGCAGCGGGATCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [171-382]  4.6e-20 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit