close all open/close all

CDS information : A4092_00400


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction72,740 / 73,537 / + [in whole cluster]
72,740 / 73,537 / + [in contig]
Location72740..73537 [in whole cluster]
72740..73537 [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)putative DpgD protein
Genedbv34
dpgD
Gene (GenBank)dbv34
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52797
NITE
Chlor_00310
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [putative DpgD protein]
MSEPRVRYEKKEHVAHVTMNRPHVLNAMDRRMHEELAEIWDDVEADDDVRTVVLTGAGTR
AFSVGQDLKERALLDEAGTQASTFGSRGQAGHPRLTDRFTLSKPVVARVHGYALGGGFEL
VLACDLVIASEEAVFGLPEVRLGLIPGAGGVFRLPRQLPQKVAMGHLLTGRRMDAATAFR
YGLVNEVVPLDELDRCVAGWTDDLVRAAPLSVRAIKEAAMRSLDIPLEEAFTTSYPWEER
RRRSGDAIEGVRAFVEKRDPVWTSR
selected fasta
>putative enoyl-CoA hydratase [putative DpgD protein]
ATGAGCGAGCCTCGCGTGCGCTACGAGAAGAAGGAACACGTCGCCCATGTGACGATGAAC
CGGCCCCACGTGCTGAACGCGATGGATCGCCGGATGCACGAGGAGCTCGCCGAGATCTGG
GACGACGTCGAGGCCGACGACGACGTCAGGACGGTCGTCCTGACCGGTGCGGGAACGCGG
GCCTTCTCCGTCGGCCAGGACCTCAAGGAACGCGCGCTGCTGGACGAGGCGGGCACGCAG
GCCTCGACGTTCGGCAGCCGGGGGCAGGCAGGTCATCCCCGGCTGACCGACCGCTTCACC
TTGTCCAAGCCGGTGGTCGCCCGGGTGCACGGCTACGCGCTGGGTGGCGGCTTCGAGCTG
GTGCTCGCCTGCGACCTCGTCATCGCCTCCGAGGAGGCGGTGTTCGGCCTGCCGGAGGTC
CGGCTCGGCCTGATCCCCGGGGCGGGAGGCGTGTTCCGGCTGCCGCGGCAGCTGCCGCAG
AAGGTGGCGATGGGCCATCTGCTGACCGGGCGCCGGATGGATGCGGCCACGGCGTTCCGG
TACGGATTGGTGAACGAGGTCGTACCGCTTGATGAGCTGGATCGGTGCGTGGCCGGATGG
ACCGACGACCTCGTACGCGCCGCTCCGCTGTCTGTTCGCGCGATCAAGGAGGCCGCCATG
CGGTCGCTCGACATTCCCCTGGAGGAGGCGTTCACCACGTCCTACCCATGGGAAGAGCGT
CGTCGGCGTAGCGGCGATGCGATCGAGGGCGTCCGGGCGTTCGTCGAGAAGAGGGACCCG
GTCTGGACGTCGAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [8-257]  2.19999999999997e-59 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [106-126]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit