close all open/close all

CDS information : A4092_00410


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction73,534 / 74,820 / + [in whole cluster]
73,534 / 74,820 / + [in contig]
Location73534..74820 [in whole cluster]
73534..74820 [in contig]
TypeCDS
Length1,287 bp (428 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)putative integral membrane ion antiporter
Gene
Gene (GenBank)dbv35
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q939X8
NITE
Balhi_00270
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [putative integral membrane ion antiporter]
MIPPHTLLVFFVQAAALLLLALLLGRLAVRLGLAAVVGELCAGVILGPSVLGQVAPGAEQ
WLFPSPSSHMLDAVGQLGVLLLIGLTGAHLDLRLIRRQGATAVRVSAFGLVVPMALGIGA
GLLLPAEFRGTGGSAVFALFLGVTMCVSSIPVIAKTLMDMNLLHRNVGQLTLTAGMIDDA
FGWVLLSVVTAMATAGAGAGTVVLSIASLLGVIVFSVVIGRPAVRVALRTTEDQGVIAGQ
VVVLVLAAAAGTHALGLEPIFGAFVAGLLVSTAMPNPVRLAPLRTVTLGVLAPLYFATMG
LRVDLTALARPEVLAVGLLVLALAIIGKFLGAFLGAWTSRLSRWEALALGAGMNARGVIQ
MIVATVGLRLGVITDEIFTIIIVVAVITSLLAPPLLRLAMTRIEATAEEEARLLAYGLRP
GEAREDVR
selected fasta
>putative transporter [putative integral membrane ion antiporter]
ATGATCCCCCCGCACACGTTGCTGGTCTTCTTCGTTCAGGCTGCGGCCCTCCTGCTGCTC
GCGTTGCTCCTGGGCCGCCTGGCCGTACGGCTGGGCCTGGCGGCGGTCGTCGGCGAACTG
TGTGCCGGCGTCATCCTCGGCCCCTCCGTGCTGGGGCAGGTCGCGCCCGGGGCGGAGCAG
TGGCTGTTTCCCTCGCCGTCGTCACACATGCTGGACGCCGTCGGGCAGCTCGGCGTGTTG
TTGCTGATCGGCTTGACGGGCGCGCATCTGGATCTGCGGCTGATCCGGCGGCAGGGCGCC
ACGGCGGTGCGGGTGAGCGCCTTCGGGTTGGTCGTGCCGATGGCCCTCGGCATCGGCGCC
GGCCTGTTGCTGCCGGCCGAGTTCCGCGGGACCGGCGGCTCGGCCGTCTTCGCCCTGTTC
CTGGGGGTGACGATGTGTGTCAGCTCGATCCCCGTGATCGCCAAGACGCTGATGGACATG
AACCTGCTCCATCGCAACGTCGGCCAGCTCACGCTGACCGCCGGCATGATCGACGACGCC
TTCGGGTGGGTGCTGCTTTCGGTGGTGACGGCGATGGCCACCGCCGGAGCCGGTGCGGGG
ACCGTGGTGCTGTCGATCGCGTCGCTGCTCGGGGTGATCGTCTTCAGCGTCGTCATCGGC
AGGCCGGCGGTCCGGGTGGCGTTGCGGACGACGGAGGATCAGGGGGTGATCGCCGGCCAG
GTCGTGGTGCTGGTGCTCGCGGCCGCGGCCGGGACGCATGCGCTGGGCCTCGAACCGATC
TTCGGGGCCTTCGTCGCCGGGCTGCTGGTGAGCACGGCCATGCCGAATCCGGTCAGACTG
GCACCGCTGCGCACGGTGACGCTCGGGGTGCTGGCTCCCCTCTATTTCGCCACCATGGGC
CTGCGCGTCGATCTCACGGCCCTGGCGCGGCCGGAGGTGCTCGCCGTGGGGCTGCTGGTC
CTGGCCCTGGCGATCATCGGCAAGTTCCTGGGCGCCTTCCTGGGCGCCTGGACCAGCCGG
CTCAGCCGATGGGAGGCCTTGGCGCTGGGGGCGGGGATGAACGCCCGTGGCGTCATCCAG
ATGATCGTGGCGACGGTCGGCCTGCGGCTGGGGGTGATCACTGACGAGATCTTCACGATC
ATCATCGTGGTGGCGGTGATCACCTCTCTGCTCGCCCCGCCACTCCTGCGCCTGGCCATG
ACCAGGATCGAGGCCACCGCCGAGGAGGAGGCCCGCCTCCTCGCCTACGGGCTGCGCCCC
GGCGAGGCCCGGGAAGACGTACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [16-397]  3.40000000000004e-59 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [5-24]  Transmembrane (o-i) [31-53]  Transmembrane (i-o) [73-95]  Transmembrane (o-i) [102-124]  Transmembrane (i-o) [134-153]  Transmembrane (o-i) [166-188]  Transmembrane (i-o) [198-220]  Transmembrane (o-i) [241-263]  Transmembrane (i-o) [278-300]  Transmembrane (o-i) [313-335]  Transmembrane (i-o) [377-399]  Transmembrane (o-i)
Transmembrane 11