close all open/close all

CDS information : A4092_00420


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction75,642 / 74,887 / - [in whole cluster]
75,642 / 74,887 / - [in contig]
Locationcomplement(74887..75642) [in whole cluster]
complement(74887..75642) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)putative type II thioesterase
Gene
Gene (GenBank)dbv36
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>putative type II thioesterase [putative type II thioesterase]
MSTWFRCFDRRPLATMRLICFPHAGGSAVFYRNWHRLAAPEIEVHAVQYPGRADRLHEPL
VGDAHRLAESVGRELRPLLDRPVALFGHSMGSLIAYETARLLTGSGIPPAHLFVSGGVAA
HDRGRLAHRVAPASEEALIDRLRLLGGTDAEALASAEFRAFALPYVRNDFQLVQSYRHTP
GPPLTVPITAFTGADDPVVRLDAVARWAELTAREFSCHVLPGGHFFLGHEQAALWAHLHA
RLGIATPAHCG
selected fasta
>putative type II thioesterase [putative type II thioesterase]
ATGTCCACCTGGTTTCGGTGTTTCGACAGGCGGCCGCTCGCCACGATGCGGCTGATCTGT
TTTCCGCACGCGGGCGGTTCGGCGGTCTTCTACCGGAATTGGCACCGGCTGGCCGCGCCG
GAGATAGAAGTGCACGCGGTTCAGTATCCGGGCCGCGCCGACCGGTTGCACGAACCCCTC
GTCGGTGATGCCCACCGGCTCGCGGAGTCGGTGGGGCGTGAGCTGAGGCCGCTCCTCGAC
CGGCCGGTGGCGCTGTTCGGGCACAGTATGGGCAGTTTGATCGCTTACGAGACGGCGCGG
CTTCTCACCGGGTCCGGTATCCCGCCGGCTCATCTCTTCGTCTCCGGAGGTGTGGCCGCG
CACGACCGTGGCCGTCTCGCGCATCGGGTGGCGCCGGCCTCCGAGGAGGCGCTCATCGAC
AGGCTGCGCCTGTTGGGCGGCACCGATGCCGAGGCGCTCGCGAGCGCGGAGTTCCGGGCG
TTCGCCCTCCCCTACGTGCGCAACGACTTCCAGCTCGTCCAGTCCTACCGCCACACGCCT
GGGCCGCCCCTGACGGTGCCGATCACGGCGTTCACCGGTGCGGACGATCCCGTCGTACGG
CTCGACGCGGTCGCGCGATGGGCCGAGTTGACGGCTCGGGAGTTCTCCTGCCACGTCCTG
CCCGGAGGCCACTTCTTCCTGGGGCACGAGCAGGCTGCTCTGTGGGCGCACCTGCACGCG
CGGCTGGGCATCGCGACCCCGGCCCACTGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [17-239]  4.39999999999997e-50 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit