close all open/close all

CDS information : A4092_00430


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction75,810 / 77,096 / + [in whole cluster]
75,810 / 77,096 / + [in contig]
Location75810..77096 [in whole cluster]
75810..77096 [in contig]
TypeCDS
Length1,287 bp (428 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative aminotransferase
Product (GenBank)putative HpgT aminotransferase
Genedbv37
hpgT
Gene (GenBank)dbv37
EC number2.6.1.-
Keyword
  • Hpg
  • Dpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52815
NITE
Chlor_00180
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
ACC
Q939Y4
NITE
Balhi_00210
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)

close this sectionSequence

selected fasta
>putative aminotransferase [putative HpgT aminotransferase]
MDSHVLAHQLSKETLHGSLMDPAIESMNLLNEIAGNYPDAISMAAGRPYEEFFDVGLIHD
YLEAYRDHLRNDRRMDDAGISRMLFQYGTTKGIISDLVARHLAEDENIEADPASVVITVG
FQEAMFLVLRALRANERDVLLAPTPTYVGLTGAALLTDTPVWPVQSTDNGIDLDHLEHQL
KRAQDQGARVRACYVTPNFANPTGTSMDLPARHRLLEVAAAHGILILEDNAYGLLGQDRL
PTLKSLDHAATVVYLGSFAKTGMPGARVGYVVADQHVAGGGSLADELAKLKGMLTVNTSP
IAQAVIAGKLLRHDFSLARANARETAIYQRNLHLTLDELTRRLGAVPGVTWNAPTGGFFI
TVTVPFVVDDELLEHAARDHGVLFTPMHHFYGGKDGFNQLRLSISLLNPQLIEEGVSRLA
GLVTACLP
selected fasta
>putative aminotransferase [putative HpgT aminotransferase]
ATGGACTCCCACGTTCTCGCCCATCAATTGAGCAAGGAAACGCTGCACGGATCGCTGATG
GACCCGGCCATCGAGTCGATGAATCTACTGAACGAGATTGCCGGCAACTACCCCGACGCC
ATTTCCATGGCCGCGGGCCGGCCGTACGAGGAGTTCTTCGACGTCGGCCTCATCCACGAC
TATCTGGAGGCCTACCGCGACCATCTCCGCAACGACCGGCGGATGGATGACGCCGGGATC
AGCCGCATGCTTTTCCAATACGGGACCACGAAGGGGATCATCTCCGACCTTGTCGCCCGG
CACCTCGCCGAGGACGAGAACATCGAGGCCGACCCGGCCTCCGTGGTCATCACTGTGGGC
TTCCAGGAGGCCATGTTCCTGGTGCTTCGCGCGCTGCGAGCGAACGAGCGGGACGTCCTG
CTCGCCCCCACGCCCACCTACGTCGGCCTGACCGGAGCGGCGCTGCTCACCGACACCCCT
GTCTGGCCGGTCCAGTCCACCGACAACGGCATCGACCTCGACCACCTTGAGCACCAACTG
AAACGCGCCCAGGACCAGGGCGCCCGGGTCCGGGCCTGCTACGTGACCCCGAACTTCGCC
AACCCCACCGGCACCAGCATGGACCTGCCCGCCCGCCATCGCCTCCTGGAGGTCGCCGCG
GCCCACGGCATCCTGATCCTGGAGGACAACGCGTACGGACTCCTCGGCCAGGACCGCCTC
CCCACGCTGAAGTCCCTCGACCATGCGGCGACCGTCGTCTACCTCGGCTCCTTCGCCAAG
ACCGGCATGCCCGGCGCCCGGGTCGGCTACGTCGTGGCGGACCAGCACGTAGCGGGGGGC
GGCTCGCTCGCCGACGAGCTCGCGAAGCTCAAGGGCATGCTCACCGTGAACACCTCGCCC
ATCGCCCAGGCGGTGATCGCCGGCAAGCTGCTGCGCCACGACTTCAGCCTGGCCCGGGCC
AACGCCCGCGAGACCGCCATCTACCAGCGCAACCTCCACCTCACGCTGGACGAACTCACC
CGCCGGCTCGGCGCCGTCCCGGGAGTCACCTGGAACGCGCCGACGGGCGGGTTCTTCATC
ACCGTCACCGTGCCCTTCGTCGTGGATGACGAGCTGTTGGAACACGCTGCCCGCGATCAT
GGCGTTTTGTTCACGCCGATGCATCACTTCTATGGTGGGAAGGATGGGTTCAACCAGCTT
CGGCTGTCGATCAGCCTGCTCAACCCGCAACTGATCGAGGAGGGTGTCTCCCGGCTTGCC
GGGCTCGTCACCGCATGTCTCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [78-419]  1.6e-34 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [77-299]  5.30000000000001e-44 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [300-422]  1.8e-09 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [1-423]  4.89996723796399e-75 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit