close all open/close all

CDS information : A4092_00440


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction77,423 / 77,842 / + [in whole cluster]
77,423 / 77,842 / + [in contig]
Location77423..77842 [in whole cluster]
77423..77842 [in contig]
TypeCDS
Length420 bp (139 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF7; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MTRPLRVNFAPVGDALGKVLVVDDDEVIRQLIAVNLNLEGFEVVTATDGQDCLDRVRDVM
PDVITLDVMMPFLDGWTTAQRLRAEEDTSHIKVVLITARAQDDDKIRGWGIGVDAYLTKP
FDPAELIEVVRELAAGARG
selected fasta
>[hypothetical protein]
GTGACCAGGCCGCTACGCGTTAACTTTGCGCCCGTGGGCGACGCTCTTGGGAAAGTACTG
GTAGTAGACGACGACGAGGTCATCCGGCAGCTCATCGCGGTGAACCTGAACCTGGAGGGG
TTCGAGGTCGTGACCGCCACGGATGGGCAGGACTGTCTGGATCGGGTGCGGGACGTCATG
CCCGATGTCATCACGCTTGATGTGATGATGCCGTTCCTGGACGGGTGGACGACGGCGCAG
CGGTTGCGGGCGGAGGAGGACACCAGTCACATCAAGGTGGTGCTGATCACGGCCAGGGCG
CAGGACGACGACAAGATCCGGGGGTGGGGGATCGGGGTGGACGCGTATCTGACCAAGCCC
TTCGATCCGGCTGAGTTGATCGAGGTGGTGCGGGAGCTGGCGGCTGGGGCGCGGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [19-130]  3e-27 PF00072
PF00072   Response_reg
 [18-134]  PS50110
PS50110   RESPONSE_REGULATORY
 [17-130]  1.10000150671643e-38 SM00448
SM00448   REC
IPR011006 CheY-like superfamily (Domain)
 [18-135]  7.20002719778969e-36 SSF52172
SSF52172   CheY_like
SignalP No significant hit
TMHMM No significant hit