close all open/close all

CDS information : A4092_00450


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction77,990 / 78,658 / + [in whole cluster]
77,990 / 78,658 / + [in contig]
Location77990..78658 [in whole cluster]
77990..78658 [in contig]
TypeCDS
Length669 bp (222 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF8; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MRSSVFRNLDPQQLPPGFALENGKMLRVQLPHEVLAKQGSMVAFQGRMDFDYEGSGGIGK
MFKKAMTGEGASLMRVRGEGLLYLADNADDIHLFYLENEGITVNGRNLLAFQPQLTWDIQ
RVQGAGMAAGGLFNTTVTGTGWVAVTTHGTPVLLDAARMPTFADGQSAVCWSAGLQVGVN
RTLKAGALIGRGSGEAMQLAFTGQGFVLVQASEGAPVVQAAR
selected fasta
>[hypothetical protein]
GTGCGTAGTTCGGTCTTTCGGAATCTCGATCCGCAGCAGTTGCCTCCGGGGTTCGCGCTT
GAGAACGGCAAGATGCTGCGGGTCCAGCTCCCGCACGAGGTGCTGGCCAAGCAGGGGTCC
ATGGTCGCCTTCCAGGGGCGGATGGACTTCGACTACGAGGGCTCCGGCGGCATCGGGAAG
ATGTTCAAGAAGGCCATGACGGGTGAGGGCGCCTCGCTGATGCGGGTGCGTGGTGAAGGG
CTGCTCTACCTGGCCGACAACGCCGACGACATCCACCTGTTCTACCTGGAGAACGAGGGG
ATCACGGTCAACGGGCGCAACCTGCTGGCCTTCCAGCCGCAGCTCACCTGGGACATCCAG
CGGGTTCAGGGGGCCGGGATGGCGGCCGGTGGGCTGTTCAACACCACGGTGACGGGGACC
GGGTGGGTGGCGGTGACCACGCATGGCACGCCGGTGCTGCTGGATGCGGCGCGCATGCCG
ACCTTCGCGGACGGGCAGTCGGCTGTGTGCTGGAGCGCGGGGTTGCAGGTCGGGGTCAAT
CGGACGTTGAAGGCGGGGGCGCTGATCGGGCGGGGGAGCGGGGAGGCCATGCAGCTGGCG
TTCACGGGGCAGGGGTTCGTGCTGGTGCAGGCCAGTGAGGGGGCTCCTGTGGTGCAGGCG
GCCCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002838 Mitochondrial biogenesis protein AIM24 (Family)
 [22-213]  7.29999999999999e-46 PF01987
PF01987   AIM24
IPR016031 Tryptophan RNA-binding attenuator protein-like (Domain)
 [15-222]  4.19999771339582e-43 SSF51219
SSF51219   TrpBP
SignalP No significant hit
TMHMM No significant hit