close all open/close all

CDS information : A4092_00460


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction78,655 / 79,155 / + [in whole cluster]
78,655 / 79,155 / + [in contig]
Location78655..79155 [in whole cluster]
78655..79155 [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF9; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MSAKASPYAAYERLIADLDAAGARYRLIDHAPEGRTEQVSALRGHDVAQAAKCLIVMVKI
GKKRTRHVLAVVPGDARLDLQAVKALLDGTYVAFAGTEKAEELAGSVSGTVLPFSYDPRL
ELVADPSLLDQPELYFNAARLDRSVALATADYVRLAAPRVAPITSN
selected fasta
>[hypothetical protein]
TTGAGCGCGAAGGCGTCGCCGTACGCCGCCTACGAGCGTCTGATCGCCGACCTGGACGCC
GCAGGAGCGCGGTACAGGCTGATCGACCACGCGCCCGAGGGCCGTACCGAGCAGGTCAGC
GCGTTGCGCGGGCACGACGTGGCGCAGGCGGCCAAGTGCCTGATCGTGATGGTCAAGATC
GGCAAGAAGCGGACCAGGCACGTGCTGGCCGTCGTCCCCGGCGACGCGCGCCTCGATCTG
CAGGCGGTCAAGGCGCTGCTCGACGGCACGTACGTGGCCTTCGCCGGCACGGAGAAGGCC
GAGGAGCTGGCGGGCAGCGTGAGCGGGACCGTGCTCCCGTTCAGCTACGACCCCCGGCTC
GAGCTGGTCGCGGATCCGTCCCTGCTGGACCAGCCCGAGCTGTACTTCAACGCTGCCAGG
CTCGACCGCTCCGTGGCGCTCGCCACCGCCGACTACGTACGGCTGGCGGCACCCCGCGTG
GCACCCATCACGAGCAACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007214 YbaK/aminoacyl-tRNA synthetase-associated domain (Domain)
 [8-163]  5.00000909915354e-34 SSF55826
SSF55826   YbaK/aa-tRNA-synth-assoc-reg
 [35-155]  2.7e-21 PF04073
PF04073   YbaK
 [10-164]  4.9e-34 G3DSA:3.90.960.10
G3DSA:3.90.960.10   YbaK/aa-tRNA-synth-assoc-reg
SignalP No significant hit
TMHMM No significant hit