close all open/close all

CDS information : A4092_00470


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction80,188 / 79,142 / - [in whole cluster]
80,188 / 79,142 / - [in contig]
Locationcomplement(79142..80188) [in whole cluster]
complement(79142..80188) [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF10; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MRSRIASVTAALVALAAAVLFATTATASAAPIRIMPLGDSITGSPGCWRALLWNRLQSAG
HTDIDFVGTLPPQGCGVAHDGDNEGHGGYLATNIANQNLLPGWLSATRPDIVVMHLGTND
VWSNIAPATILSAFTTLVNQMRAGNPNTKILVAKIIPMNPSSCAECAQRTVNFNDAIPAW
AAATTTPQSPITVVDQWTGFSTATDTYDGVHPNAAGDQKMSDKWYPALVTALAGGGTATP
TVTSTVTPPPGKCTATYQATGQWQGGFQGEVTVKNTGTTPRSAWTVAWTFANGQQITQLW
GGTLSATGSSVTVRNAAWNGTLAPGASTTFGFLGSWNGANTAPAPSCS
selected fasta
>[hypothetical protein]
ATGCGCAGCAGGATCGCCTCCGTAACGGCCGCGCTGGTGGCGCTGGCCGCAGCGGTGTTA
TTCGCCACCACGGCCACGGCCAGCGCCGCCCCCATCAGGATCATGCCGCTGGGCGACTCG
ATCACCGGATCCCCCGGCTGCTGGCGGGCCCTGCTCTGGAACCGCCTTCAGAGCGCCGGC
CACACCGACATCGACTTCGTCGGCACCCTGCCCCCGCAGGGCTGCGGAGTGGCCCACGAC
GGCGACAACGAGGGTCACGGCGGCTATCTCGCCACCAACATCGCCAACCAGAACCTGTTG
CCCGGCTGGCTCTCCGCCACCCGGCCCGACATCGTGGTGATGCACCTGGGCACCAACGAC
GTGTGGAGCAACATCGCCCCGGCGACGATCCTCAGCGCGTTCACGACGCTGGTGAACCAG
ATGCGGGCCGGTAACCCGAACACGAAGATCCTCGTCGCCAAGATCATCCCGATGAACCCG
TCCTCCTGCGCCGAATGCGCCCAGCGCACCGTGAACTTCAACGACGCCATCCCCGCCTGG
GCCGCCGCGACCACCACCCCGCAGTCGCCGATCACGGTCGTGGACCAGTGGACGGGCTTC
AGCACCGCCACCGACACCTACGACGGGGTGCACCCGAACGCGGCCGGCGACCAGAAGATG
TCCGACAAGTGGTACCCGGCCCTGGTGACCGCCCTGGCCGGCGGTGGCACCGCCACCCCC
ACCGTCACCAGCACCGTCACGCCGCCTCCCGGCAAATGCACGGCCACGTACCAGGCGACG
GGGCAGTGGCAGGGCGGCTTCCAGGGCGAGGTCACCGTCAAGAACACCGGCACCACGCCG
AGGTCCGCCTGGACCGTGGCGTGGACGTTCGCCAACGGTCAGCAGATCACCCAGCTGTGG
GGCGGCACGCTGAGCGCCACCGGGTCGTCGGTGACCGTGCGCAACGCCGCGTGGAACGGC
ACGCTGGCGCCGGGGGCCTCGACCACGTTCGGCTTCCTGGGCTCCTGGAACGGCGCCAAC
ACCGCTCCGGCCCCTAGTTGCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001919 Cellulose-binding domain, family II, bacterial-type (Domain)
 [253-347]  7.79998304125571e-43 SM00637
SM00637   CBD_II
 [246-348]  PS51173
PS51173   CBM2
 [253-344]  6.19999999999999e-29 PF00553
PF00553   CBM_2
IPR008965 Carbohydrate-binding domain (Domain)
 [247-345]  4.49999046578037e-32 SSF49384
SSF49384   Cellul_bind
IPR012291 Cellulose-binding family II/chitobiase, carbohydrate-binding domain (Domain)
 [248-345]  6.00000000000001e-35 G3DSA:2.60.40.290
G3DSA:2.60.40.290   CBD_carb_bd
IPR013830 Esterase, SGNH hydrolase-type (Domain)
 [1-232]  2.800005042611e-32 SSF52266
SSF52266   Esterase_SGNH_hydro-type
IPR013831 Esterase, SGNH hydrolase-type, subgroup (Domain)
 [25-228]  1.40000000000001e-37 G3DSA:3.40.50.1110
G3DSA:3.40.50.1110   Esterase_SGNH_hydro-type_subgr
IPR018366 Carbohydrate-binding type-2, conserved site (Conserved_site)
 [318-331]  PS00561
PS00561   CBM2_A
SignalP
 [1-29]  0.76 Signal
Bacteria, Gram-positive   
 [1-29]  0.858 Signal
Eukaryota   
 [1-29]  0.881 Signal
Bacteria, Gram-negative   
TMHMM
 [5-27]  Transmembrane (i-o)
Transmembrane 1