close all open/close all

CDS information : A4092_00480


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction81,178 / 80,333 / - [in whole cluster]
81,178 / 80,333 / - [in contig]
Locationcomplement(80333..81178) [in whole cluster]
complement(80333..81178) [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF11

close this sectionSequence

selected fasta
>[hypothetical protein]
MLRTVMIIVGVDGSRTGLEAAGWAAAEAQLRQEPLTVAHAVPKWVCEGAVRYAEVAQWMR
DGAETVLNAACDRARRVWPQVSMEGVLLPGDPRSALVKASEGATLLVVGSRGIGGVRGLL
VGSVAYGVAAHAPTNVILIHDPPAAPRAEVVAGTDGSPCAARAMEFAFAEAELRGARLRA
VQAWAWPHPGGFEPASRESEQDTLRSLKESLSVHRERHPGVHVVAEVVHGHPVEVLKEAA
RRADLLVVGSRGHGQLAGMLIGSISQGLLHHAPCPMAVVRG
selected fasta
>[hypothetical protein]
ATGTTACGCACTGTCATGATCATCGTCGGTGTGGACGGCTCCCGTACCGGGCTGGAGGCC
GCCGGCTGGGCCGCCGCCGAGGCCCAGCTGCGTCAGGAGCCGCTGACCGTGGCGCACGCC
GTGCCGAAGTGGGTGTGCGAGGGCGCCGTCCGCTACGCCGAGGTGGCCCAGTGGATGCGC
GACGGCGCCGAGACCGTGCTCAACGCCGCCTGCGACCGCGCGCGACGGGTGTGGCCGCAG
GTGTCCATGGAAGGCGTGTTGCTGCCGGGCGACCCCCGCTCGGCGCTGGTCAAGGCCTCG
GAGGGGGCCACGCTGCTGGTCGTGGGCAGCCGCGGGATCGGCGGGGTGCGGGGCCTGCTC
GTCGGGTCGGTCGCGTACGGGGTGGCGGCGCACGCGCCTACGAACGTCATCCTGATCCAC
GACCCGCCCGCTGCCCCGCGCGCGGAGGTCGTCGCGGGCACCGACGGGTCGCCCTGCGCC
GCGCGGGCGATGGAGTTCGCCTTCGCCGAGGCCGAGCTGCGCGGCGCGCGGCTGCGTGCC
GTGCAGGCGTGGGCCTGGCCCCATCCCGGCGGCTTCGAGCCGGCCTCCCGTGAGAGCGAG
CAGGACACGCTGCGTTCCCTGAAGGAGTCGCTGAGCGTGCACCGGGAGCGGCACCCCGGC
GTGCACGTGGTGGCCGAGGTGGTGCACGGGCATCCGGTGGAGGTGCTCAAGGAAGCCGCC
AGGCGCGCCGACCTGCTGGTGGTGGGCTCGCGCGGGCACGGGCAGCTCGCGGGCATGCTC
ATCGGCTCCATCAGCCAGGGCCTGCTGCACCATGCCCCGTGCCCGATGGCGGTGGTGCGC
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006015 Universal stress protein A (Family)
 [147-165]  8.1000073432326e-16 PR01438 [240-252]  8.1000073432326e-16 PR01438 [258-280]  8.1000073432326e-16 PR01438
PR01438   UNVRSLSTRESS
IPR006016 UspA (Domain)
 [7-140]  3.60000000000001e-18 PF00582 [150-280]  5.59999999999999e-27 PF00582
PF00582   Usp
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [7-139]  1.29999999999998e-61 G3DSA:3.40.50.620 [140-280]  1.29999999999998e-61 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP No significant hit
TMHMM No significant hit