close all open/close all

CDS information : A4092_00490


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction81,706 / 83,250 / + [in whole cluster]
81,706 / 83,250 / + [in contig]
Location81706..83250 [in whole cluster]
81706..83250 [in contig]
TypeCDS
Length1,545 bp (514 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF12; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MTDARFFKIYTGELRVPMRQVHLSNGSSVTLYDTSGPYTDPAYEPDLRRGLPRLREQWVR
ERQAVGHPVTQVGCARRGLVTREMEFVAVREGVTPEFVRQEVAAGRAIIPANVNHPETEP
MIIGREFLVKINANIGNSAVSSSIEEEVEKMTWATRWGADTIMDLSTGADIRETREWILR
NSPVPVGTVPIYQALEKVKGRPELLSWEVYRDTLIEQCEQGVDYVTVHAGVRLAHVPLTA
GRKTGIVSRGGSIMAAWCLAHHRESFLYENFAEMCEILARYDVSYSLGDGLRPGSIADAN
DEAQFAELRTLGELTGIAREHDVQVMIEGPGHVPMHKIKENVDLQRELCDDAPFYTLGPL
VTDIAPGYDHITSGIGAAMIGWYGTAMLCYVTPKEHLGLPDKDDVKTGVITYKIAAHAAD
LAKGHPQAQAWDDALSDARFEFRWEDQFDLSLDPETARSFHDETLPAAPAKTAHFCSMCG
PKFCSMRISHEIRDAGYAEKAAEFRRLGGTLYVE
selected fasta
>[hypothetical protein]
ATGACGGACGCGCGCTTTTTCAAGATCTACACCGGTGAGCTGCGGGTGCCGATGCGTCAG
GTGCACCTGTCCAACGGCTCGTCGGTGACGCTGTACGACACCTCGGGCCCGTACACCGAC
CCCGCCTACGAGCCCGACCTCCGCCGTGGCCTGCCGCGCCTGCGCGAGCAGTGGGTCCGC
GAGCGCCAGGCGGTGGGTCACCCGGTCACGCAGGTCGGGTGCGCCCGGCGCGGGCTGGTG
ACCAGGGAGATGGAGTTCGTGGCGGTACGCGAGGGCGTCACGCCCGAGTTCGTCCGCCAG
GAGGTCGCCGCGGGCCGGGCCATCATCCCCGCGAACGTCAACCACCCCGAGACCGAGCCC
ATGATCATCGGCCGCGAGTTCCTCGTGAAGATCAACGCCAACATCGGCAACTCCGCCGTC
TCCTCCTCGATCGAGGAGGAGGTGGAGAAGATGACCTGGGCCACGCGCTGGGGCGCCGAC
ACGATCATGGACCTGTCGACCGGCGCCGACATCCGCGAGACCCGCGAGTGGATCCTGCGC
AACTCGCCGGTCCCGGTCGGCACCGTGCCCATCTACCAGGCGCTGGAGAAGGTCAAGGGC
CGCCCGGAGCTGCTGTCGTGGGAGGTCTACCGCGACACGCTGATCGAGCAGTGCGAGCAG
GGCGTCGACTACGTGACCGTGCACGCGGGCGTGCGGCTGGCGCACGTGCCGCTCACCGCC
GGCCGCAAGACCGGCATCGTCTCGCGCGGCGGCTCGATCATGGCCGCCTGGTGCCTGGCG
CACCATCGCGAGAGCTTCCTGTACGAGAACTTCGCCGAGATGTGCGAGATCCTGGCCCGC
TACGACGTGTCGTACTCGCTCGGCGACGGCCTGCGCCCCGGCTCCATCGCCGACGCCAAC
GATGAGGCCCAGTTCGCCGAGCTGCGCACGCTGGGCGAGCTGACGGGGATCGCCAGGGAG
CACGACGTCCAGGTGATGATCGAGGGGCCGGGCCACGTCCCCATGCACAAGATCAAGGAG
AACGTGGACCTGCAGCGCGAGCTGTGCGACGACGCCCCGTTCTACACGCTCGGCCCGCTC
GTGACGGACATCGCGCCCGGCTACGACCACATCACCTCGGGCATCGGGGCCGCCATGATC
GGCTGGTACGGCACGGCCATGCTCTGCTACGTCACCCCCAAGGAGCACCTCGGCCTGCCC
GACAAGGACGACGTGAAGACCGGCGTGATCACGTACAAGATCGCCGCTCATGCGGCGGAC
CTGGCCAAGGGTCATCCACAAGCGCAGGCGTGGGACGACGCGCTGTCGGACGCGCGGTTC
GAGTTCCGCTGGGAGGACCAGTTCGACCTGTCGCTGGACCCCGAGACGGCCCGCTCGTTC
CACGACGAGACGCTGCCGGCGGCGCCCGCCAAGACCGCGCACTTCTGCTCGATGTGCGGC
CCGAAGTTCTGCTCGATGCGGATCAGCCACGAGATCAGGGACGCGGGGTACGCGGAGAAG
GCGGCCGAGTTCCGGCGGCTCGGAGGCACGCTCTACGTGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002817 Thiamine biosynthesis protein ThiC (Family)
 [69-493]  TIGR00190
TIGR00190   ThiC
 [70-492]  PF01964
PF01964   ThiC
IPR025747 ThiC-associated domain (Domain)
 [12-65]  1.2e-18 PF13667
PF13667   ThiC-associated
SignalP No significant hit
TMHMM No significant hit