close all open/close all

CDS information : A4092_00500


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction84,547 / 83,696 / - [in whole cluster]
84,547 / 83,696 / - [in contig]
Locationcomplement(83696..84547) [in whole cluster]
complement(83696..84547) [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF13; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MSQTPPPQNQPYPGHTGEMAPEPRDEMRDYVGRALLDGKKALITGGDSGIGRAVAVAFAK
EGADVAIAYLTEHEDAAHTRKLVEQAGRRCVLLPGDLADRAHCSSVVEQAVSELGGLDVL
VNNVAYQAPVSGLEELDDEQWEHTFAVNIHSYYRVTKAALAHLREGAAIVNTSSINGLRG
NKSLIDYAATKGAINAFTYSMAQNLVERGIRVNAVAPGPVWTPLIPATMPEEKVEKFGKQ
VPMGRAADPDEIAPSYVFFASNRLSSYYTGEVLAPIGGRDAAG
selected fasta
>[hypothetical protein]
ATGTCGCAAACACCACCACCGCAGAACCAGCCCTACCCCGGCCACACCGGCGAGATGGCG
CCAGAGCCGCGCGACGAGATGCGCGACTACGTGGGCCGCGCCCTGCTCGACGGCAAGAAG
GCACTGATCACCGGCGGTGACTCGGGCATCGGGCGGGCGGTCGCGGTGGCGTTCGCCAAG
GAGGGCGCGGACGTCGCGATCGCGTACCTGACCGAGCACGAGGACGCTGCGCACACGCGC
AAGCTGGTCGAGCAGGCGGGGCGGCGCTGTGTGCTGCTGCCCGGCGACCTGGCCGACCGC
GCCCACTGCTCCTCGGTCGTCGAGCAGGCGGTCTCCGAGCTGGGCGGCCTGGACGTGCTG
GTGAACAACGTGGCCTACCAGGCGCCGGTGAGCGGCCTGGAGGAGCTGGACGACGAGCAG
TGGGAGCACACGTTCGCGGTCAACATCCACAGCTACTACCGCGTCACGAAGGCCGCGCTC
GCGCATCTGCGCGAGGGCGCGGCCATCGTGAACACCTCGTCGATCAACGGCCTGCGCGGC
AACAAGTCGCTCATCGACTACGCCGCCACCAAGGGCGCCATCAACGCCTTCACCTACTCC
ATGGCGCAGAACCTGGTCGAGCGCGGCATCCGCGTGAACGCCGTCGCGCCGGGCCCGGTG
TGGACGCCGCTGATCCCGGCGACGATGCCGGAGGAGAAGGTGGAGAAGTTCGGCAAGCAG
GTGCCGATGGGGCGGGCGGCCGATCCGGACGAGATCGCCCCGTCGTATGTGTTCTTCGCC
TCGAACCGGCTGTCGTCGTACTACACGGGCGAGGTGCTGGCCCCCATCGGCGGCAGAGAC
GCTGCCGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [115-126]  3.49999851148921e-08 PR00080 [167-175]  3.49999851148921e-08 PR00080 [187-206]  3.49999851148921e-08 PR00080
PR00080   SDRFAMILY
 [40-204]  2.90000000000001e-31 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [40-57]  4.10001399699315e-37 PR00081 [115-126]  4.10001399699315e-37 PR00081 [161-177]  4.10001399699315e-37 PR00081 [187-206]  4.10001399699315e-37 PR00081 [208-225]  4.10001399699315e-37 PR00081 [242-262]  4.10001399699315e-37 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [36-279]  5.20000000000001e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [174-202]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit