close all open/close all

CDS information : A4092_00510


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction85,538 / 84,588 / - [in whole cluster]
85,538 / 84,588 / - [in contig]
Locationcomplement(84588..85538) [in whole cluster]
complement(84588..85538) [in contig]
TypeCDS
Length951 bp (316 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF14; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MRALLALLVLVAACGLRPASSFVPPVEPGSIRPVPGLDGAPIRVTSKEFTEQLVLGKIAV
LALTAAGADVADQTNVQGSVNARASLTRGDADLMWEYTGTGWITYLGQARPIPDHTRQYE
AVRDLDLRENGIVWLPPAPLNNSYTIGVTRATAERYGLTKISDLTKIPVAQRTFCVDHET
FGRDDGFLGMLRGYGLTYGEDVPRANVRRVSVGVLYDSVAGGQCALGMVTTTDGRIKALD
LVLLEDDRHFFPLYNASVTLRRPVADAHPEIARIFAPISAKLTDDVMRALNAQVDVDGDV
PVLVARDWLRSQGFVR
selected fasta
>[hypothetical protein]
GTGAGAGCGCTGCTCGCCCTGCTGGTGCTGGTCGCGGCGTGCGGCCTGCGGCCCGCCTCG
TCGTTCGTGCCGCCGGTCGAGCCGGGCAGCATCCGGCCGGTGCCCGGCCTCGACGGCGCG
CCAATCCGGGTGACGTCCAAGGAGTTCACGGAGCAGCTCGTGCTCGGCAAGATCGCGGTG
CTCGCCCTCACCGCCGCCGGCGCGGATGTGGCCGACCAGACGAACGTGCAGGGCAGCGTC
AACGCCCGCGCCTCGCTGACCAGGGGCGACGCCGACCTCATGTGGGAGTACACCGGCACC
GGCTGGATCACCTACCTCGGCCAGGCCCGCCCGATCCCGGACCACACCCGGCAGTACGAG
GCCGTACGCGACCTGGACCTGCGCGAGAACGGCATCGTCTGGCTGCCCCCCGCTCCGCTG
AACAACAGCTACACGATCGGCGTCACGCGAGCCACGGCCGAGAGGTACGGGCTGACGAAG
ATCTCGGACCTGACGAAGATCCCCGTGGCTCAGCGTACGTTCTGCGTCGACCACGAGACC
TTCGGCCGCGACGACGGCTTCCTCGGCATGCTCAGGGGCTACGGGCTGACCTACGGCGAG
GACGTCCCCAGGGCGAACGTGCGCAGGGTGTCGGTCGGCGTCCTGTACGACTCGGTCGCC
GGCGGCCAGTGCGCGCTCGGCATGGTCACCACCACCGACGGCCGGATCAAGGCACTCGAC
CTGGTCCTGCTGGAGGACGACCGGCACTTCTTCCCGCTGTACAACGCGTCGGTGACCCTG
CGCCGCCCGGTCGCCGACGCGCATCCGGAGATCGCCCGCATCTTCGCCCCGATCAGCGCG
AAGCTGACCGACGACGTGATGCGCGCGCTCAACGCCCAGGTGGACGTGGACGGCGACGTG
CCCGTGCTGGTGGCCCGCGACTGGCTCAGGTCACAGGGATTCGTGAGATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007210 ABC-type glycine betaine transport system, substrate-binding domain (Domain)
 [41-310]  2.89999999999999e-60 PF04069
PF04069   OpuAC
SignalP
 [1-21]  0.877 Signal
Eukaryota   
 [1-21]  0.632 Signal
Bacteria, Gram-negative   
 [1-21]  0.53 Signal
Bacteria, Gram-positive   
TMHMM No significant hit