close all open/close all

CDS information : A4092_00520


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction86,311 / 85,535 / - [in whole cluster]
86,311 / 85,535 / - [in contig]
Locationcomplement(85535..86311) [in whole cluster]
complement(85535..86311) [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF15; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MTVESAAAKEATTPEPRIGRSWHVVLPPLCYLAVAVAMVAYTQIVPLDSIERGSLNLPFL
LRRTWEHIQLVFFSTVLVLVVALPLGVLLTRRALRRATPVVLALVNLGQATPAVGLVVLL
AVLFSIGFWTAVAALFAYSLLPTLRNTMVGIEQVDPRLVDAGRGIGMSAAGVLFKVELPM
AVPVILSGVRTTLVLNVGTAGIAAFIGSGGLGDLITAGVSTQRNLVLITGCVLIAVLALI
IDWLGGLAQRYLSPKGLA
selected fasta
>[hypothetical protein]
GTGACGGTCGAGAGCGCGGCGGCCAAGGAGGCGACCACCCCGGAGCCCCGGATCGGGCGG
TCGTGGCACGTCGTCCTGCCCCCGCTGTGCTACCTGGCCGTCGCGGTGGCGATGGTCGCC
TACACGCAGATCGTGCCGCTCGACAGCATCGAACGCGGCTCGCTGAACCTGCCGTTCCTG
CTCAGGCGCACGTGGGAGCACATCCAGCTGGTGTTCTTCTCCACCGTGCTGGTGCTGGTG
GTGGCGCTGCCGCTGGGCGTGCTGCTGACCAGGCGGGCGCTGCGCCGGGCCACCCCGGTC
GTGCTGGCCCTGGTGAACCTGGGCCAGGCCACCCCGGCGGTGGGCCTGGTGGTGCTGCTG
GCGGTGCTGTTCAGCATCGGGTTCTGGACGGCGGTGGCCGCACTGTTCGCCTACAGCCTG
CTGCCCACGCTGCGCAACACCATGGTGGGCATCGAGCAGGTGGACCCACGGCTGGTGGAC
GCGGGCCGGGGCATCGGCATGTCGGCGGCGGGGGTGCTGTTCAAGGTGGAGCTGCCGATG
GCGGTGCCGGTCATCCTGTCGGGCGTGCGGACCACGCTGGTGCTGAACGTGGGCACGGCC
GGCATCGCGGCGTTCATCGGCTCCGGCGGGCTCGGCGATCTGATCACCGCGGGAGTGAGC
ACGCAGCGCAACCTGGTCCTGATCACCGGATGCGTGCTGATCGCGGTGCTCGCGCTGATC
ATCGACTGGCTGGGCGGGCTCGCGCAGCGCTACCTGTCGCCGAAGGGGCTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [64-245]  PS50928
PS50928   ABC_TM1
 [83-248]  7.20000000000002e-18 PF00528
PF00528   BPD_transp_1
SignalP No significant hit
TMHMM
 [25-47]  Transmembrane (i-o) [67-89]  Transmembrane (o-i) [116-138]  Transmembrane (i-o) [164-186]  Transmembrane (o-i) [193-215]  Transmembrane (i-o) [225-247]  Transmembrane (o-i)
Transmembrane 6