close all open/close all

CDS information : A4092_00530


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction87,483 / 86,308 / - [in whole cluster]
87,483 / 86,308 / - [in contig]
Locationcomplement(86308..87483) [in whole cluster]
complement(86308..87483) [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF16; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MAEQATGGVPIELRKVTKAFPGGGEPAVQELDLNIPAGEIVVLLGPSGCGKTTTMRMINR
LIEPSSGDILIGGQNSRDIDPDRLRRHIGYVIQQAGLFPHMTVAANIAQVPKMLGWERGR
VAERVDELLTLVGLDPGTFRESYPRRLSGGQQQRVGVARALAADPPVLLMDEPFGALDPI
SRERIQDELLRLQEELAKTIVFVTHDVDEALKLGDHIAIMQRPGHVVQYARPAEILTNPA
SDYVEQFLGGGSSMRLLRLTQVGDIELDAVPYASEDMDARDLLREVELDGRGYALILDGM
RRPLRWVTQAALEGVHGPVGPAGDPITGSIGHRMTLQDALETLLNADTDFLPVLSRRRAY
AGALSLATVQNAIQAIKARERERRLRRGEAR
selected fasta
>[hypothetical protein]
GTGGCTGAGCAGGCCACCGGCGGCGTGCCGATCGAGCTGCGCAAGGTGACCAAGGCGTTC
CCCGGCGGCGGCGAGCCGGCCGTCCAGGAGCTGGACCTGAACATCCCGGCAGGCGAGATC
GTGGTCCTGCTCGGCCCCTCGGGCTGCGGCAAGACGACCACCATGCGCATGATCAACCGC
CTGATCGAGCCGTCCTCCGGCGACATCCTCATCGGCGGCCAGAACTCCCGCGACATCGAC
CCCGACCGCCTGCGCAGGCACATCGGCTACGTGATCCAGCAGGCCGGCCTGTTCCCGCAC
ATGACGGTCGCGGCCAACATCGCCCAGGTCCCGAAGATGCTCGGCTGGGAGCGCGGGCGC
GTCGCCGAGCGCGTGGACGAGCTGCTCACGCTCGTGGGCCTGGACCCTGGAACGTTCCGG
GAGAGCTACCCGCGCCGGCTGTCCGGCGGCCAGCAGCAGCGGGTCGGCGTGGCCAGGGCG
CTGGCCGCCGACCCGCCCGTGCTGCTCATGGACGAGCCGTTCGGCGCCCTCGACCCCATC
AGCCGCGAGCGCATCCAGGACGAGTTGCTGCGGCTGCAGGAAGAGCTGGCCAAGACGATC
GTCTTCGTCACCCACGACGTGGACGAGGCGCTCAAGCTCGGCGACCACATCGCCATCATG
CAGCGGCCCGGGCACGTCGTGCAGTACGCCAGACCCGCCGAGATCCTCACGAACCCGGCC
AGCGACTACGTCGAGCAGTTCCTCGGCGGCGGCTCCTCGATGCGGCTGCTGCGCCTGACT
CAGGTGGGCGACATCGAGCTGGACGCGGTGCCGTACGCGTCGGAGGACATGGACGCCCGC
GACCTGCTGCGCGAGGTGGAGCTGGACGGCCGCGGCTACGCGCTGATCCTCGACGGCATG
CGCCGCCCGCTCAGGTGGGTCACCCAGGCGGCGCTCGAAGGCGTGCACGGCCCGGTCGGC
CCGGCCGGCGACCCGATCACGGGCTCCATCGGCCACCGCATGACCCTTCAGGACGCCCTG
GAGACGCTGCTCAACGCCGACACCGACTTCCTGCCGGTGCTGAGCAGGCGCCGGGCGTAC
GCGGGGGCGCTGTCGCTGGCCACGGTGCAGAACGCGATCCAGGCCATCAAGGCCCGCGAG
CGGGAGCGCCGCCTGCGCAGGGGCGAGGCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [11-248]  PS50893
PS50893   ABC_TRANSPORTER_2
 [52-174]  1e-22 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [37-233]  5.59999989417023e-23 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [147-161]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit