close all open/close all

CDS information : A4092_00540


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction88,129 / 87,476 / - [in whole cluster]
88,129 / 87,476 / - [in contig]
Locationcomplement(87476..88129) [in whole cluster]
complement(87476..88129) [in contig]
TypeCDS
Length654 bp (217 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF17; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MNLWEYIEDRWDLIVFETVQHASMVAQCVLVATVLGVLVGVATYRRPRPSAFATAVAGVL
FTIPSLAMLGLLIPPLGLGVAPSVTAIVLYALLPIIRNTVVGLRGVDPALVDAARGIGMS
RHRSLTRVELSLAWPVILTGIRVATQLAMGIAAVAAYVSGPGLGEQIFSGLARLGGANAV
NSTLTGTIGVAILALLFDGCFVLLGKLTTPGTGAVRG
selected fasta
>[hypothetical protein]
ATGAACCTGTGGGAGTACATCGAGGACCGATGGGACCTCATCGTCTTCGAGACCGTGCAG
CACGCCAGCATGGTCGCCCAGTGCGTGCTGGTCGCGACCGTCCTCGGCGTGCTGGTCGGC
GTGGCCACCTACCGCCGCCCCAGGCCGTCGGCCTTCGCCACGGCGGTGGCGGGGGTGCTG
TTCACGATCCCGTCGCTGGCCATGCTCGGCCTGCTGATCCCGCCACTCGGCCTCGGGGTG
GCGCCGAGCGTGACCGCGATCGTGCTGTACGCGCTGCTGCCGATCATCCGCAACACCGTG
GTGGGCCTGCGCGGCGTGGACCCGGCGCTGGTCGACGCCGCGCGTGGGATCGGCATGAGC
CGCCACAGGTCGCTCACCAGGGTGGAGCTCTCGCTGGCCTGGCCGGTGATCCTGACGGGC
ATCAGGGTCGCCACGCAGCTCGCGATGGGCATCGCCGCCGTGGCCGCCTACGTCTCGGGC
CCCGGCCTGGGCGAGCAGATCTTCTCGGGCCTGGCCAGGCTGGGCGGCGCGAACGCGGTC
AACTCCACCCTGACCGGCACCATCGGGGTGGCGATCCTGGCGCTGCTCTTCGACGGCTGC
TTCGTCCTGCTCGGGAAGCTCACCACGCCGGGCACGGGAGCCGTCCGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000515 Binding-protein-dependent transport systems inner membrane component (Family)
 [18-197]  PS50928
PS50928   ABC_TM1
 [33-204]  4.00000000000001e-16 PF00528
PF00528   BPD_transp_1
SignalP No significant hit
TMHMM
 [22-44]  Transmembrane (o-i) [51-73]  Transmembrane (i-o) [77-96]  Transmembrane (o-i) [130-152]  Transmembrane (i-o) [183-205]  Transmembrane (o-i)
Transmembrane 5