close all open/close all
A4092_00540 A4092_00540   last last

CDS information : A4092_00550


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction88,596 / 89,153 / + [in whole cluster]
88,596 / 89,153 / + [in contig]
Location88596..89153 [in whole cluster]
88596..89153 [in contig]
TypeCDS
Length558 bp (185 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF18; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MIALHDVANVASADRPKELRIARDAARGRIIQVILGILGVGGFVYTARNFTLARQQSELN
RRTLELATLQAHEQMETTRRSLTQNESAQMTDRFMRAIDQLGSEAADIRLGGIHSLERIA
QDSPRDHPAVMEALTAFVRRVSKTRSEEVPQDLQAAVTTLVRRLPDSDRGRLNLRGARMD
GLDLID
selected fasta
>[hypothetical protein]
ATGATCGCCCTGCACGACGTGGCCAATGTGGCGAGTGCCGATCGGCCGAAGGAGTTACGC
ATCGCGCGGGATGCCGCGCGCGGGCGCATCATTCAGGTCATCCTTGGAATACTGGGCGTC
GGTGGTTTCGTCTACACCGCTCGCAACTTCACGCTGGCCAGGCAGCAGAGCGAACTGAAC
CGACGAACCCTGGAACTGGCCACGCTGCAGGCACACGAGCAGATGGAAACCACTCGGCGG
TCACTCACCCAAAATGAGAGCGCGCAGATGACCGATCGGTTCATGCGAGCGATCGACCAG
TTGGGCAGTGAGGCGGCCGACATCCGGCTCGGCGGCATTCATTCGCTGGAGCGAATAGCG
CAGGACTCTCCTCGAGATCATCCGGCGGTCATGGAGGCTCTGACGGCCTTCGTACGACGA
GTATCGAAAACACGCTCGGAGGAGGTGCCACAGGATCTGCAAGCAGCCGTGACGACGCTG
GTACGCAGACTGCCGGACTCTGATCGGGGACGGTTGAATCTACGCGGTGCGCGGATGGAC
GGTCTGGACCTCATCGAT

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [30-52]  Transmembrane (o-i)
Transmembrane 1   
A4092_00540 A4092_00540   last last