close all open/close all
first first   A4793_00020 A4793_00020

CDS information : A4793_00010


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction2,022 / 766 / - [in whole cluster]
2,022 / 766 / - [in contig]
Locationcomplement(766..2022) [in whole cluster]
complement(766..2022) [in contig]
TypeCDS
Length1,257 bp (418 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)StaN
GenestaN
ORF34
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • integral membrane ion transporter
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q6BJU7
PmId
[17559408] Characterization of DhKHA1, a gene coding for a putative Na(+) transporter from Debaryomyces hansenii. (FEMS Yeast Res. , 2007)
Family/Domain
FD
IPR006153

close this sectionSequence

selected fasta
>putative transporter [StaN]
MLAGLAVTFAVAFVFARLAKRIRQPRVMGEIIAGLALGPSLLGLLPGDPVEALFPADARP
VLQALSQLGLVLFMFGIGYELDFALLRGAGSRVTLVSLSSMALPMALGAGLAVLLFPLYD
KSQLSSDGVLAPAIFLGVAMSITAFPVLARIIAENGMQRTRIGAMALACAVVQDFLAWCV
LAVAVVIATASGLWPLARMVLESGLFLGVLLYVVRPGLRRLLAPERRRAVGSSLIHAILV
TGLLVSAWATHEIGLHAVFGAFAFGAVVPHRHIEVQAPQVVERIEQTSLFLLPVFFTVTG
LSVDVGGLGRTGLIMTVAVVLVACTGKYVGAAVSARLTGASKAESRTLGVLLNARGLTEL
VILNVGLGLGVLDSRLFSAMVVMALVTTFMTGPLLHRLGFHEELRLVPAPVKNADNSV
selected fasta
>putative transporter [StaN]
ATGCTCGCGGGCCTCGCGGTGACCTTCGCCGTGGCATTCGTCTTCGCCCGGCTCGCCAAG
CGCATTCGGCAACCCAGGGTCATGGGAGAGATCATCGCCGGTCTTGCCCTGGGGCCGAGC
CTGTTGGGCCTCTTACCGGGAGACCCCGTCGAAGCGTTGTTCCCGGCGGACGCACGGCCG
GTCCTTCAGGCGCTCTCGCAGCTCGGACTCGTCCTGTTCATGTTCGGCATCGGCTACGAA
CTGGACTTCGCCCTTCTTCGGGGGGCCGGCAGCCGGGTCACCTTGGTCTCACTCAGCTCC
ATGGCGCTGCCGATGGCGCTGGGGGCCGGGCTCGCCGTTCTCCTCTTCCCTCTGTACGAC
AAGTCGCAGCTCAGCAGCGACGGTGTGCTCGCCCCGGCGATCTTCCTCGGGGTGGCGATG
TCGATCACGGCGTTCCCGGTGCTGGCCCGGATCATCGCGGAAAACGGCATGCAACGCACC
CGCATCGGTGCCATGGCGCTCGCCTGTGCCGTCGTCCAGGACTTCCTCGCCTGGTGTGTA
CTGGCCGTTGCCGTGGTGATCGCCACCGCAAGTGGTCTGTGGCCGCTGGCGCGGATGGTG
CTGGAGTCCGGCCTGTTCCTGGGCGTCCTCCTCTACGTCGTGCGACCGGGGCTGCGTCGG
CTGCTGGCCCCGGAGCGGAGGCGGGCGGTCGGCAGCTCCCTGATCCACGCCATCCTCGTC
ACCGGACTGCTGGTGTCCGCCTGGGCGACCCACGAGATCGGCCTGCACGCCGTCTTCGGT
GCCTTCGCCTTCGGCGCCGTGGTGCCCCACCGCCACATAGAGGTGCAGGCCCCCCAGGTC
GTCGAGCGCATCGAGCAGACCAGTCTCTTTCTGCTGCCGGTCTTCTTCACCGTGACCGGC
CTGTCGGTGGACGTCGGCGGGCTCGGCAGAACCGGCCTGATCATGACCGTCGCCGTCGTG
CTGGTGGCCTGCACGGGGAAGTACGTCGGCGCCGCCGTCTCCGCACGACTGACCGGCGCC
TCGAAGGCCGAGTCGAGAACGCTCGGCGTCCTGCTCAACGCCCGCGGACTCACAGAACTG
GTCATCCTGAACGTGGGCCTCGGGCTCGGCGTGCTGGACAGTCGTCTGTTCAGTGCCATG
GTCGTCATGGCACTGGTCACCACCTTCATGACGGGACCACTGCTGCACCGCCTCGGATTC
CACGAGGAACTGCGACTGGTTCCGGCTCCCGTGAAGAACGCGGACAACAGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006153 Cation/H+ exchanger (Domain)
 [7-397]  1.79999999999997e-68 PF00999
PF00999   Na_H_Exchanger
SignalP No significant hit
TMHMM
 [27-49]  Transmembrane (i-o) [64-86]  Transmembrane (o-i) [93-115]  Transmembrane (i-o) [130-152]  Transmembrane (o-i) [164-186]  Transmembrane (i-o) [196-218]  Transmembrane (o-i) [230-249]  Transmembrane (i-o) [253-275]  Transmembrane (o-i) [287-309]  Transmembrane (i-o) [313-335]  Transmembrane (o-i) [348-370]  Transmembrane (i-o) [374-396]  Transmembrane (o-i)
Transmembrane 12   
first first   A4793_00020 A4793_00020