close all open/close all

CDS information : A4793_00020


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction4,071 / 2,485 / - [in whole cluster]
4,071 / 2,485 / - [in contig]
Locationcomplement(2485..4071) [in whole cluster]
complement(2485..4071) [in contig]
TypeCDS
Length1,587 bp (528 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)StaM
GenestaM
ORF33
Gene (GenBank)
EC number
Keyword
  • Bht
Note
Note (GenBank)
  • putative nonheme iron dioxygenase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q7WZ63
NITE
A4092_00340
PmId
[16499611] A derivative of the glycopeptide A40926 produced by inactivation of the beta-hydroxylase gene in Nonomuraea sp. ATCC39727. (FEMS Microbiol Lett. , 2006)

close this sectionSequence

selected fasta
>putative hydroxylase [StaM]
MTEEQLFLRSDTIIEPLVDRFYAQLYTTAPVSGTMNLAFRQIPMLESYLQTPDYHFSGSR
DPKFRGGFFVGIEEKRKGEVEALLAAIRRDRADMIRFAEAIAEAEKIVREEATGYDLRSL
YPKLPSELAGLVEVTYDTGNQASLHFLEPLAYQSKAYTEDRQSVQLSLETGIERPFVMST
PRLPSSDVLELDIPFRHPGIEELFLSRIRPTTVAALREALELGDAEAAQLSRLLVAEPGL
AADRHVTAGTRIRYWGHACLLLQTPEVSILTDPFISADTSATDRYTYDDLPDHIDYVVIT
HGHSDHLVAETLLQLRGRVGTFVVPRTSRGNLCDPSLALFLKCLGLPVIEVDDFDEVPFP
GGKIVATPFFGEHADLDIRAKSTYWISIGGKSVYVGADSSGIDPVLYRYVRRHLGRVDIA
FLGMECDGAPMNWKYQPMLTQPIPKKMSDTRKLSGSNAEQASAIVTELGAEEVYIYAMGE
ESWLGHVMATSYNEDSYQLQQIAEFEEWCTRQGVKAGHLLNRAEWHWA
selected fasta
>putative hydroxylase [StaM]
GTGACAGAGGAACAACTCTTTCTCCGGTCCGACACCATCATCGAGCCATTGGTCGACCGG
TTCTACGCCCAGCTGTACACGACGGCTCCAGTGAGCGGCACCATGAACCTGGCCTTCCGG
CAGATCCCGATGCTGGAGTCCTACCTGCAGACCCCGGACTACCACTTCTCGGGTAGTCGC
GATCCGAAGTTCCGCGGCGGATTCTTCGTCGGTATCGAGGAGAAGCGGAAGGGCGAGGTC
GAGGCGCTGCTTGCGGCCATCCGGCGCGACCGTGCGGACATGATCCGGTTCGCCGAGGCG
ATCGCTGAGGCCGAGAAGATCGTTCGGGAGGAGGCGACCGGCTACGACCTCAGGTCGCTC
TACCCGAAGCTGCCCTCCGAACTGGCCGGCCTGGTGGAAGTCACCTATGACACCGGCAAC
CAGGCCTCGCTGCACTTCCTGGAGCCGCTCGCCTACCAGAGCAAGGCCTACACCGAGGAC
CGCCAGTCGGTACAGCTCTCGCTGGAGACGGGCATCGAGCGGCCGTTCGTGATGAGCACC
CCACGGCTGCCCTCTTCCGACGTGCTGGAGCTGGACATCCCCTTCCGGCACCCCGGCATC
GAGGAGCTGTTCCTCTCCCGGATCCGGCCCACCACCGTGGCCGCGCTCCGCGAGGCGCTG
GAGCTAGGCGACGCGGAAGCCGCCCAGCTGTCCCGCCTGCTGGTCGCGGAGCCGGGGCTG
GCCGCCGACCGCCACGTCACGGCCGGAACCAGGATCCGTTACTGGGGGCATGCCTGCCTC
CTCCTGCAGACGCCCGAGGTGTCGATCCTCACGGACCCGTTCATCAGCGCCGACACCAGC
GCGACCGACCGGTACACCTATGACGACCTGCCCGACCACATCGACTACGTCGTCATCACA
CACGGGCATTCCGACCACCTCGTGGCCGAAACCCTGCTCCAGCTGCGTGGCCGGGTCGGC
ACATTCGTCGTGCCGAGGACATCGCGCGGCAATCTGTGCGACCCCTCGCTGGCGCTCTTC
CTGAAATGCCTCGGGCTCCCCGTCATCGAGGTGGACGACTTCGACGAGGTGCCCTTCCCC
GGCGGGAAGATCGTCGCCACTCCCTTCTTCGGGGAGCACGCCGATCTCGACATTCGCGCC
AAGTCGACCTACTGGATCAGTATCGGGGGGAAGTCCGTCTACGTGGGAGCGGACTCCTCC
GGCATCGATCCGGTCCTCTACCGCTATGTCCGTCGGCATCTCGGACGGGTCGACATCGCA
TTTCTCGGCATGGAGTGCGACGGCGCGCCGATGAACTGGAAGTACCAGCCCATGCTCACC
CAGCCGATCCCGAAGAAGATGAGTGACACCCGCAAACTGTCCGGTTCCAACGCGGAGCAG
GCGAGCGCGATCGTCACCGAGCTGGGGGCGGAAGAGGTGTACATCTACGCCATGGGTGAG
GAGAGTTGGCTCGGCCACGTCATGGCCACCAGTTACAACGAGGACTCCTACCAGCTTCAG
CAGATCGCCGAGTTCGAGGAATGGTGCACGCGCCAGGGAGTCAAGGCCGGCCATCTGCTC
AACCGGGCCGAATGGCACTGGGCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [255-306]  3.1e-05 PF00753
PF00753   Lactamase_B
 [256-424]  0.000529999948508985 SM00849
SM00849   Lactamase_B
IPR019204 Domain of unknown function DUF2070, membrane (Domain)
 [312-490]  6.80000000000006e-40 PF09843
PF09843   DUF2070
SignalP No significant hit
TMHMM No significant hit