close all open/close all

CDS information : A4793_00030


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction4,963 / 4,151 / - [in whole cluster]
4,963 / 4,151 / - [in contig]
Locationcomplement(4151..4963) [in whole cluster]
complement(4151..4963) [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productsulfotransferase
Product (GenBank)StaL
GenestaL
ORF32
Gene (GenBank)
EC number2.8.2.-
Keyword
Note
Note (GenBank)
  • sulfotransferase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
[16492565] Biosynthesis of sulfated glycopeptide antibiotics by using the sulfotransferase StaL. (Chem Biol. , 2006)
[17329243] Crystal structure of StaL, a glycopeptide antibiotic sulfotransferase from Streptomyces toyocaensis. (J Biol Chem. , 2007)
[22753479] Sulfonation of glycopeptide antibiotics by sulfotransferase StaL depends on conformational flexibility of aglycone scaffold. (Proc Natl Acad Sci U S A. , 2012)

close this sectionSequence

selected fasta
>sulfotransferase [StaL]
MNGMCWIASYPKAGGHWLRCMLTSYVTGEPVETWPGIQAGVPHLEGLLRDGEAPSADPDE
QVLLATHFTADRPVLRFYRESTAKVVCLIRNPRDAMLSLMRMKGIPPEDVEACRKIAETF
IADEGFSSVRIWAGEGSWPENIRSWTDSVHESFPNAAVLAVRYEDLRKDPEGELWKVVDF
LELGGRDGVADAVANCTLERMREMEERSKLLGLETTGLMTRGGKQLPFVGKGGQRKSLKF
MGDDIEKAYADLLHGETDFAHYARLYGYAE
selected fasta
>sulfotransferase [StaL]
ATGAACGGGATGTGCTGGATCGCCTCCTACCCGAAGGCCGGAGGCCACTGGCTCCGGTGC
ATGCTGACGTCCTACGTCACCGGCGAGCCGGTCGAGACCTGGCCGGGCATCCAGGCCGGG
GTGCCGCACCTCGAAGGGTTGTTGCGTGACGGGGAGGCCCCCTCCGCCGACCCGGACGAG
CAGGTCCTGCTGGCGACGCACTTCACCGCGGACCGCCCGGTGCTGCGGTTCTACCGGGAG
TCCACCGCCAAGGTGGTCTGCCTGATCCGGAACCCGCGCGACGCGATGCTCAGCCTGATG
CGGATGAAGGGGATTCCGCCGGAGGACGTCGAGGCCTGCCGGAAGATCGCCGAGACGTTC
ATCGCCGACGAGGGATTCTCGTCGGTGCGCATCTGGGCCGGCGAAGGATCATGGCCGGAG
AACATACGCAGTTGGACGGACTCGGTGCACGAGAGCTTCCCGAACGCCGCCGTCCTCGCG
GTGCGGTACGAGGACCTTCGGAAGGACCCCGAAGGGGAGCTGTGGAAGGTCGTGGACTTC
CTCGAACTCGGTGGACGGGACGGTGTGGCGGACGCGGTGGCGAACTGCACCCTGGAGCGG
ATGCGGGAGATGGAGGAGCGGAGCAAGCTCCTCGGCCTGGAGACGACGGGACTGATGACC
CGTGGGGGAAAGCAGCTGCCTTTCGTGGGCAAGGGCGGGCAGCGGAAGTCGCTGAAATTC
ATGGGCGACGACATCGAGAAGGCCTATGCGGACCTCCTCCATGGGGAAACCGATTTCGCC
CACTATGCCCGTCTCTATGGATACGCTGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000863 Sulfotransferase domain (Domain)
 [6-206]  4.80000000000001e-17 PF00685
PF00685   Sulfotransfer_1
SignalP No significant hit
TMHMM No significant hit