close all open/close all

CDS information : A4793_00060


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction9,003 / 7,534 / - [in whole cluster]
9,003 / 7,534 / - [in contig]
Locationcomplement(7534..9003) [in whole cluster]
complement(7534..9003) [in contig]
TypeCDS
Length1,470 bp (489 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)StaI
GenestaI
ORF29
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • Nonheme halogenase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q7WZ81
NITE
A4092_00160
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
ACC
O87676
NITE
Balhi_00140
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)
ACC
G4V4R7
NITE
Vanco_00150
PmId
[24756572] Bis-chlorination of a hexapeptide-PCP conjugate by the halogenase involved in vancomycin biosynthesis. (Org Biomol Chem. , 2014)
ACC
R4T052
PmId
[24884615] Complete genome sequence and comparative genomic analyses of the vancomycin-producing Amycolatopsis orientalis. (BMC Genomics. , 2014)

close this sectionSequence

selected fasta
>putative halogenase [StaI]
MSVETFDVVVAGGGPGGSTVAALVAMQGHRVLLLEKEVFPRYQIGESLLPSTVHGVCRLL
GVTDELAAAKFPVKRGGTFRWGARPEPWTFSFAVSPRMTGPTSFAYQVERARFDEILLNN
AKSKGVTVREGCSVTAVVEEGDRVTGLRYTDSDGGEHEVGARFVIDASGNKSRLHASVGG
TREYSEFFRSLALFGYFENGKRLPEPYSGNILSVAFDSGWFWYIPLSDTLTSVGVVVRRE
MAEKIQGDREKAYNALIAECPLIAEYLSDARRVTTGNYGELRVRKDYSYHQTKFWRPGMI
LVGDAACFVDPVFSSGVHLATYSALLAARSINSVLAGDLDEKTAFDEFEGRYRREYGVFY
EFLVSFYQMNVNEESYFWHAKKVTNNEHTEFESFVDLVGGVASGETALAASRLAERSAEF
AGAVDQMAGGDDGDMVPLFKSHVVKQVMQEGGQVQMKAVLGEDAAPEEPVFPGGLVSSPD
GMKWLPYRG
selected fasta
>putative halogenase [StaI]
ATGTCGGTGGAAACGTTCGACGTTGTGGTGGCGGGAGGCGGACCGGGGGGTTCGACCGTG
GCCGCCCTGGTCGCCATGCAGGGCCACCGAGTGCTGCTGCTGGAGAAAGAGGTATTCCCG
CGGTATCAGATAGGCGAGTCATTACTTCCGTCCACGGTTCACGGGGTGTGCCGGCTGCTG
GGTGTCACCGATGAACTCGCGGCGGCTAAATTCCCGGTGAAGCGCGGCGGTACTTTCCGC
TGGGGTGCCAGGCCGGAACCGTGGACGTTCTCCTTCGCGGTGTCCCCGCGGATGACCGGG
CCGACCTCGTTCGCCTATCAGGTGGAACGGGCGCGGTTCGACGAGATCCTGCTGAACAAC
GCCAAGAGCAAGGGTGTGACGGTCCGCGAGGGATGCTCGGTCACCGCGGTGGTCGAGGAG
GGCGACCGGGTCACCGGCCTGCGGTACACCGACTCCGACGGCGGTGAGCACGAGGTCGGC
GCGCGTTTCGTGATCGACGCGTCGGGCAACAAGAGCCGGCTGCACGCCAGCGTCGGTGGT
ACTCGCGAATACTCGGAGTTCTTCCGCAGCCTGGCCCTGTTCGGCTATTTCGAGAACGGC
AAACGGCTTCCGGAGCCCTATTCGGGCAATATTCTGAGCGTCGCCTTCGACAGCGGCTGG
TTCTGGTACATTCCGCTGAGCGACACGCTCACCAGCGTGGGCGTGGTGGTCCGCCGCGAA
ATGGCCGAAAAGATCCAGGGCGACCGGGAAAAGGCCTACAACGCCCTGATCGCCGAATGT
CCGCTGATCGCGGAGTATCTGTCGGACGCGCGTCGGGTGACGACCGGGAATTACGGGGAA
CTGCGGGTACGCAAAGACTATTCCTACCACCAGACGAAGTTCTGGCGCCCGGGAATGATT
CTCGTGGGCGACGCCGCGTGTTTCGTCGACCCGGTGTTCTCCTCCGGCGTGCATCTGGCG
ACCTACAGCGCCCTGCTGGCCGCCCGTTCGATCAACAGCGTGCTCGCGGGCGACCTGGAC
GAGAAGACCGCCTTCGACGAGTTCGAGGGCCGGTACCGTCGGGAATACGGGGTCTTCTAC
GAGTTCCTCGTGTCGTTCTACCAGATGAACGTGAACGAGGAATCGTATTTCTGGCACGCC
AAGAAGGTCACGAACAACGAGCACACGGAGTTCGAGTCCTTCGTGGACCTGGTCGGCGGG
GTGGCGTCCGGCGAGACGGCGCTCGCGGCGTCCAGGCTCGCCGAGCGCAGCGCCGAGTTC
GCCGGCGCCGTCGACCAGATGGCGGGCGGTGACGACGGGGACATGGTGCCGCTGTTCAAG
TCGCACGTGGTCAAGCAGGTGATGCAGGAGGGCGGCCAGGTCCAGATGAAGGCGGTCCTC
GGCGAGGACGCCGCACCGGAGGAGCCTGTCTTCCCTGGCGGGCTGGTGTCCTCGCCCGAC
GGGATGAAGTGGCTTCCCTACCGTGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [7-29]  1.4e-07 PR00420 [160-175]  1.4e-07 PR00420 [296-311]  1.4e-07 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [7-94]  5.3e-24 PF04820 [98-402]  3.5e-78 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit