close all open/close all

CDS information : A4793_00090


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction12,613 / 11,438 / - [in whole cluster]
12,613 / 11,438 / - [in contig]
Locationcomplement(11438..12613) [in whole cluster]
complement(11438..12613) [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)StaF
GenestaF
oxyA
ORF26
Gene (GenBank)
EC number
Keyword
  • 3rd cross-linking
  • D-O-E ring
Note
Note (GenBank)
  • P450-related oxidase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>cytochrome P450 [StaF]
MFEEINVVRASQLHRRDRFDPVPELHSLMKEGGLTVLGTEDSTEGRTAWLATGIDEVRQV
LGSDKFSARLLYGGTAAGITWPGFLTQYDPPEHTRLRRMVVPAFSHRRMQKFRPRVEQIV
QDSLDTIESLGGPVDFVPHFGWAIATPATCDFLGIPRDDQADLARILLASRTDRSDKRRT
AAGNKFMTYMKQHVAQSRRGSGDDLFGIVGRENGDAITDAELTGVAAFVMGAAADQVARL
LAAGAWLMVEQPAQFALLREKPETVPEWLDETMRYLTTDEKTHPRVATQDVRIGNQLVKA
GDTVTCSLLAANRPNYPSAEDEFDITREKAEHLAFGHGIHHCLGRAMAELMFKVSIPALA
HRFPTLRLADPQREITLGPPPFDVEALLLDW
selected fasta
>cytochrome P450 [StaF]
ATGTTCGAGGAGATCAACGTCGTCCGGGCGTCGCAGTTGCACCGGAGGGACCGGTTCGAT
CCGGTGCCCGAACTCCACTCCCTGATGAAGGAGGGTGGCCTGACCGTCCTCGGAACCGAG
GACTCCACCGAGGGGCGGACCGCGTGGCTCGCCACCGGGATCGACGAGGTCCGGCAGGTC
CTCGGCTCGGACAAGTTCAGCGCCCGCCTGCTCTACGGAGGGACCGCGGCCGGCATCACC
TGGCCGGGCTTCCTCACCCAGTACGACCCGCCGGAGCACACGCGGCTCCGCCGGATGGTG
GTGCCCGCGTTCTCCCACCGCCGGATGCAGAAATTCCGGCCGCGGGTCGAGCAGATCGTC
CAGGACAGCCTGGACACCATCGAGTCGCTCGGCGGCCCGGTGGACTTCGTCCCGCACTTC
GGATGGGCCATCGCGACGCCGGCGACCTGCGACTTCCTCGGCATTCCCCGTGACGACCAG
GCGGACCTGGCACGGATCCTCCTCGCCAGCCGGACCGACCGGTCGGACAAGCGGCGCACC
GCGGCGGGGAACAAGTTCATGACCTACATGAAGCAGCATGTCGCCCAGTCGCGCCGCGGC
TCCGGCGACGACCTGTTCGGCATCGTGGGGCGCGAGAACGGTGACGCCATCACGGATGCC
GAGCTGACGGGGGTGGCCGCGTTCGTCATGGGCGCTGCCGCCGACCAGGTGGCCCGTCTC
CTCGCGGCGGGCGCGTGGCTGATGGTCGAACAGCCCGCGCAGTTCGCTCTGCTCAGGGAG
AAGCCCGAGACCGTACCGGAGTGGCTGGACGAGACCATGCGGTACCTCACGACCGACGAG
AAGACCCATCCGCGCGTCGCGACCCAGGACGTGCGGATCGGGAACCAGCTCGTCAAGGCC
GGCGACACCGTCACGTGCTCCCTGCTGGCCGCCAACCGCCCGAACTACCCGAGTGCGGAG
GACGAGTTCGACATCACACGGGAGAAGGCGGAGCATCTGGCGTTCGGGCACGGCATCCAT
CACTGCCTCGGCAGGGCCATGGCCGAGCTGATGTTCAAGGTCTCGATTCCGGCGCTGGCG
CACCGCTTCCCCACCCTGCGGCTCGCCGATCCGCAGCGCGAGATCACGTTGGGGCCGCCG
CCGTTCGATGTGGAAGCCCTGCTGCTCGACTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [10-391]  1.59998835313644e-69 SSF48264
SSF48264   Cytochrome_P450
 [12-380]  2.30000000000004e-75 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [269-363]  3.8e-11 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [88-99]  5.49999338756182e-29 PR00359 [152-167]  5.49999338756182e-29 PR00359 [188-210]  5.49999338756182e-29 PR00359 [267-278]  5.49999338756182e-29 PR00359 [285-312]  5.49999338756182e-29 PR00359 [333-342]  5.49999338756182e-29 PR00359 [342-353]  5.49999338756182e-29 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [335-344]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit