close all open/close all

CDS information : A4793_00110


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction30,738 / 18,538 / - [in whole cluster]
30,738 / 18,538 / - [in contig]
Locationcomplement(18538..30738) [in whole cluster]
complement(18538..30738) [in contig]
TypeCDS
Length12,201 bp (4,066 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)StaC
GenestaC
ORF23
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • peptide synthetase (modules 4-6)
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)

close this sectionPKS/NRPS Module

A4 L-4-hydroxyphenylglycine(Hpg)
5 L-4-hydroxyphenylglycine(Hpg)
6 tyrosine
C7..301
A481..878
PCP956..1022
E1056..1496
C1505..1796
A1977..2369
PCP2452..2518
E2560..3004
C3013..3307
A3489..3877
PCP3963..4029

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [StaC]
MAQSRIEDIWPLSPLQEGLLFHTVYDDEGPHVYLGHWILELDGPVDPARLRTAWETLLTR
HAALRACFRQRATGETVQVVASGVDLPWRVVDLSHLDDPDEAVRELAEEDRLRRFDLAKA
PLLRLTLIRLDDATHRLVVTCHHAVMDGWSLPIVFDELQALYAAGTGSPDLPEVASYRDY
LAWLNRQDQKRALAAWAAELRGAQDPTLVAPADPGRAPGMPESITVEVPEHLTRSLEDLA
RSNGLTLNTVVQGAWALVLAQLSGRTDVVFGAVVSARPADLPGVEGMVGLFLNTVPVRVR
LDGATPVIGMLTELQRRQSALIPDQYVGLVEIQKAAGPGAIFDTLLVFENFPRDLGEPDS
PETFTVRVNQGREAAHYPLTLVAVPGDTMLLKLDHLTDLFDADAALSVIERFQGVLRHLA
ADHETTVADLAVTTAAERNLVSAWGTAPGAEPGDLPLVLFDRQAERRGDETAIVDGDRTT
SFRDLAGYADRLAGYLTGRGVGRGDRVAVVMERSTDLIATLLAVWKAGAAFVPVDPGYPV
ERVKVMLADADPAVVVCRAANRAAVLDGGLDPIVLDDPEIRRAVAECARPSVQVSADDLA
YVMYTSGSTGTPKGVAVSHGNVAALVGEPRWEIGPGDTVLTHASHAFDISLFEIWVPLLS
GARMMIAEPGAVDGEALARYVAAGVTAAHLTAGAFRVLAEESPESVAGLREVLTGGDEVP
PAAVRRVRRACPDIRVRHLYGPTETTLCATWWLLEPGDEAGGVLPIGRPLAGRRVHVLDA
FLRPVPPGVKGELYVAGAGVARGYLGRSALTAERFVADPFVPGERMYRTGDLAHWTDEGT
LVFGGRADDQVKIRGYRVEPGEIEAVLAGLPGVGQAVVLARDERLIGYVVAEEGRDLDPA
GLRERLAETMPEFMVPAAVIVLDELPLTVNGKVDRQALPDPDFASKSVGRDPATEVERIL
CRVFAEVLGLERVGVEAGFFELGGDSISSMQVAARARREGIALTPRQVFEQRTPERLARV
AGTTRSGRFEADAGIGEIPWTPVMRALGADAQRPGFAQARVVVAPPGLDRSALVAALQAV
LDTHDQLRGRVESDGRLIVPGRGTVDAAGLVTRVAAATANLDEIAGREAGTAAGVLDPST
GTMVRVVWIDAGDAEPGRLALVAHHLVVDAVSWGILLPDLRTAYEQVISGGTASLEPATT
SFRQWARRLTEQALSERTVAEIDHWVGVLDGADPFPEEHAGRPHSWSWTLSGSAARSLVG
QAPGAFHCGVQEVLLAGLAGAVARLRGGDAGVLVDLEGHGRHAADGEDLLRTVGWFTSVH
PVRLEVSGLDLAAAAAGNAAAGELLKAVKEQVRAVPGDGFGYGLLRHLNPDTGARLAELP
SPRIGFNYLGRSAAASPDTPWQVVEGPLGAGADAPDLVLAHALEVGARVQDTPGGPQVRL
TVDGRDLDPDTVERLGEAWLEMLTGLAAHAADPGAGGHTPSDFDLVDMSQRDVAELEAAA
PGLTDIWPLSPLQEGMLFERALDEEGVDVYQSQRILELDGPLDPERLRAAWQPLVARHES
LRTSFHQLGSGETVQVVVGEADIPWREADVSHLGEADAAAEVERLLAEDQAERFDVTRPP
LLRLLLIRLGENRHRLVLTSHHVLLDGWSTPIILGEMSSGYAGGPGPSTSPSYRDYLLWL
SRQEQDATLSAWRSEFAGSDEPTVVDADAGRAMVMPQEHCAWLSAESTRTLTDFARGHGL
TLSTIVQGAWALVLARLAGRTDVAFGTVVSGRPADVPDVERMVGMFINTVPVRVRLDGGL
RVLELLQDLQRRQAALTEHQYMGLSEIQKAVGPGAVFDTIMMVENYPLDAAGLGDDGGVT
ISSAVTRTGTGYPLTMSASPGERLQIRVSFRPDRIDERTAAEVAGQVVRVIERVAAEPSL
PVGRLGVTSDATRTSEVERWNATGEAAGGASVVELFRRRSAGTPDAVAVVDGDRTLSYGD
LDRESDRLAGRLAETGVRRGDHVGVVLERGADLFVAFLAVWKAGAAYVPVHVDYPPVRIE
RMLADAGVTVAVCAEGTRNAVPDGLEPVPVDAPWAGETRHETPTVTARDAAYVMYTSGST
GEPKGIVVPHGSVAALAGDPGWALDADDCVLMHASHAFDASLFEIWAPLVRGARVMVAEP
GAVDTQRLREAVARGVTTVHLTAGSFRVLAEESPGSFDGLREILTGGDVVPLASVAQLRR
ACPDVRVRHLYGPTETTLCGTWHLLEPGDEPGDVLPIGRPLAGRRAYVLDAFLQPVAPNV
TGELYLAGVGLALGYLGARGATSERFVADPFVPGERMYRTGDLARRNDRGELLFAGRADA
QVKIRGYRVEPTEIETVLAEAPQVAQTVVVAREDGPGEKRLIAYAIAEPDQVLDPEALRE
HLAARLPEFMVPAAVVVLDDFPLTINGKIDREALPAPEFSAKPAGREPRTEAERVLCALF
AEILGLDRVGADDSFFELGGDSILSMQLAARARRADVVFGAKDVFEQETPAAIAAVAERG
GAPRAELADDVGEVAWTPVMRALIERDPGALTGGALTQWVTVGAPGDLSVDALAAGLGAV
IGTHDLLRSRIVTAAGEEPGMVVSARSAVDAAGLVERVDADTGDIDEIADRCAREAAARL
DPAAGVMIRAVWVDAGPGRVGRIVLVAHHLVADAVSWQILLLDLRAACEAVSAGAEPALD
PVEVPFRRWARTLADQAAVRAAELGTWTEILDQAEPRLASLDPARDTIATAGRRSWTLPR
DRAGVLVGKAASAYHCGVHEVLLATLAGAVTRWRGGDAVVVDVEGHGRRPVGELDLSRTV
GWFTDIHPVRLDVTGIDTDEVIAGGEAAGRLLKAVKENVRTVPDGGLGYGVLRHLNAETA
PVLAALPKAEIGFNYLGRFSSRPEGDPEPWQMTGTIGGAAEEHAPLRHAVEVDAVVLDSP
DGPELRLTLTWAGRILGEAEAESLGRAWLDLLSGLAAHAALGAGGHTPCDFSLTALTQQD
VEEIEAAVPGLADIWPLSPLQEGLLFHAVDERGPDVYAGIRTLALDGPLDVARFRASWQT
LLDRHAALRASFHQLGSGQAVQAIAGEVVLPWTETDLSHLPEDEALAEAERLAEELHADR
FELDRAPLLRLHLMRISERSHRLALASHHISCDGWSLPILSGDVTAAYESGGDGRSLPAP
TSYRSYLAWLARQDKEAARQAWRSELAGLDEPTHVVPPDAVTAPVEPERLRFDMDEDLSR
RLVEFTRRHGVTMNTLFQGIWALLLARLTGRDDVVFGSAVAGRPPEIPGVESVVGLFMNT
LPVRARLDGGEPFLDMLTRLQERQVAMMAHQHVGLSEIKQLAGQGAAFDTIVVFENYPRP
PLPSEDPDALVMRPAGIPNDSGHYPISMRASHDGGVHGEFIYRPDVFDRTRAEEMLAAVV
RALEQVAADPWTLVGRVGLIGPTERGLVVEEWNATDAPFVPEPLPVLFRRRAELSRDAIA
VEDADRKLSYGGLLEEAEDLARLLAGLGVRRETRVGVLVGRSAELVVALLGVSLSGGVFV
PVDPEYPAGRIELMLTDSAPEVLLCTKATRTAVPDGFAGVVVVLDERSAADPGAALPAVA
VGDGAYVIYTSGSTGTPKGVQVTHAGLGNLAGAQIERFGVTSSSRVLQFASLGFDAAISE
LCMALLSGGTVVLADPDSMPPRVSLGDAVRRWRITHVTVPPSVLAVEEDLPDSLETLVVA
GEACPPALVDRWSGDRRMINGYGPTETTVCVTMSAPLSPGRDAPPIGRPIANMRAYVLDA
FLQPVPPGVAGELYVTGAGLARGYLGRPGLTAERFVADPFSSGGRMYRTGDRARWTREGE
LVFVGRADAQVKVRGYRVEPGEIEAVLSDHPGAAQVVIVAREDGPGEKRLVAYVVPAAAQ
PADELIAALRETAAERLPEHMRPVAFVPLDAVPLTPNGKVDHRALQAPDLAGNSSGRGPR
TAVEELLCAVFAEILGVERVGVDDSFFEIGGDSISSMQLSARLRREGLEVTPWQVFEEKT
PERLAALAKELPAEGEESSEPESDDGMLLALSPDQMDQLQSGPTDG
selected fasta
>non-ribosomal peptide synthetase [StaC]
ATGGCTCAGTCGCGGATCGAGGACATCTGGCCTCTGTCGCCACTGCAGGAAGGCCTGCTG
TTTCACACGGTCTACGACGACGAAGGGCCCCACGTCTACCTGGGTCACTGGATCCTGGAG
CTGGACGGTCCGGTCGACCCGGCCAGGTTACGCACGGCATGGGAGACGCTGCTCACCCGG
CACGCCGCGCTCAGGGCCTGCTTCCGGCAGCGTGCGACGGGTGAGACGGTGCAGGTCGTC
GCGAGCGGGGTGGACCTGCCGTGGCGGGTGGTGGATCTCTCCCACCTCGACGATCCCGAC
GAGGCGGTGCGGGAGCTCGCCGAGGAGGACCGGCTGCGGAGGTTCGACCTCGCGAAGGCC
CCGCTGCTGCGCCTCACGTTGATCCGTCTCGACGACGCCACGCACCGGCTGGTGGTGACC
TGCCATCACGCGGTCATGGACGGCTGGTCGTTGCCCATCGTGTTCGACGAGCTGCAGGCT
CTGTACGCGGCCGGCACCGGTTCGCCGGACCTGCCGGAAGTGGCGTCCTACCGGGATTAC
CTCGCCTGGCTGAACCGGCAGGACCAGAAGCGGGCGCTGGCGGCATGGGCGGCGGAGCTG
CGCGGCGCTCAGGACCCGACCCTGGTGGCGCCGGCCGACCCGGGCCGAGCGCCCGGCATG
CCGGAGAGCATCACCGTCGAGGTCCCCGAGCACCTCACCCGATCGCTGGAAGACCTGGCC
CGCAGCAACGGGCTGACGCTGAACACCGTGGTGCAGGGCGCGTGGGCGCTGGTGCTGGCG
CAGCTGTCGGGCCGGACGGACGTGGTGTTCGGGGCGGTGGTCTCGGCACGCCCGGCGGAC
CTGCCCGGCGTGGAGGGCATGGTGGGGCTGTTCCTCAACACCGTGCCCGTGCGCGTACGG
CTGGACGGTGCCACGCCGGTCATCGGCATGCTGACGGAGCTGCAGAGGCGGCAGTCGGCG
CTCATCCCGGACCAGTACGTGGGTCTGGTGGAGATCCAGAAGGCGGCCGGCCCCGGCGCG
ATCTTCGACACCCTGCTCGTCTTCGAGAACTTTCCCCGCGACCTCGGTGAACCGGACTCC
CCCGAGACCTTCACCGTTCGGGTGAACCAGGGCAGGGAGGCCGCCCACTACCCGCTGACG
CTGGTCGCCGTCCCCGGCGACACGATGCTCCTCAAGCTCGACCATCTGACCGACCTCTTC
GACGCGGACGCGGCCCTCTCCGTCATCGAGCGGTTCCAGGGGGTTCTGCGCCACCTGGCG
GCCGACCACGAGACCACCGTGGCCGACCTCGCTGTGACGACCGCCGCCGAGCGCAACCTG
GTGAGCGCGTGGGGCACGGCACCCGGCGCCGAGCCCGGCGACCTGCCGCTGGTCCTGTTC
GATCGCCAGGCGGAGCGTCGCGGAGACGAGACGGCGATCGTCGACGGAGACCGGACGACG
TCGTTCCGAGACCTGGCCGGGTATGCGGACAGGCTCGCGGGTTACCTGACCGGGCGGGGC
GTCGGGCGTGGTGATCGGGTCGCCGTGGTGATGGAGCGGTCGACCGACCTGATCGCGACG
CTGCTCGCGGTGTGGAAGGCGGGGGCGGCGTTCGTGCCGGTGGACCCCGGCTACCCGGTG
GAACGCGTGAAGGTCATGCTGGCGGACGCGGATCCGGCCGTGGTGGTGTGCCGGGCCGCG
AACCGGGCGGCCGTGCTGGACGGCGGGCTCGATCCGATCGTCCTGGACGATCCGGAGATC
CGGCGGGCCGTCGCGGAGTGCGCCCGCCCCTCGGTGCAGGTCTCAGCCGACGACCTCGCC
TACGTGATGTACACCTCGGGGTCGACGGGCACGCCCAAGGGCGTCGCGGTGTCGCACGGC
AACGTGGCGGCGCTGGTCGGGGAGCCGCGGTGGGAGATCGGGCCCGGCGACACCGTGCTG
ACGCACGCCTCCCACGCCTTCGACATCTCCCTGTTCGAGATCTGGGTGCCCCTGCTGTCC
GGCGCCCGAATGATGATCGCCGAACCGGGCGCGGTGGACGGGGAGGCCCTGGCCCGGTAC
GTGGCGGCCGGCGTCACGGCCGCGCACCTGACCGCGGGGGCCTTCCGGGTACTGGCCGAG
GAGTCACCGGAGTCGGTCGCCGGGCTTCGCGAGGTGCTGACCGGCGGGGACGAGGTGCCG
CCGGCGGCGGTGCGGCGCGTACGGCGGGCGTGCCCGGACATCCGGGTGCGGCATCTCTAC
GGCCCGACGGAGACGACGCTGTGCGCGACCTGGTGGCTGCTCGAGCCCGGCGACGAGGCC
GGAGGGGTACTGCCGATCGGACGTCCCCTCGCCGGCCGGCGCGTCCACGTCCTGGACGCG
TTCCTGCGCCCCGTTCCTCCGGGCGTGAAGGGCGAACTGTACGTCGCCGGGGCCGGTGTC
GCGCGTGGCTACCTGGGCCGTTCGGCTCTGACGGCCGAGCGGTTCGTCGCCGATCCCTTC
GTCCCCGGCGAGCGGATGTACCGGACCGGTGACCTGGCCCACTGGACGGACGAGGGCACG
CTCGTGTTCGGCGGACGTGCCGACGACCAGGTGAAGATTCGCGGCTATCGAGTGGAGCCG
GGAGAGATCGAGGCGGTCCTCGCCGGGCTTCCGGGCGTCGGTCAGGCCGTGGTCCTGGCC
CGGGACGAGCGTCTGATCGGCTATGTGGTCGCGGAAGAGGGGCGGGACCTCGACCCGGCG
GGGCTGCGGGAGCGGCTCGCCGAGACGATGCCCGAGTTCATGGTCCCGGCGGCGGTGATC
GTGCTGGACGAGTTGCCGCTGACGGTCAACGGGAAGGTGGACCGGCAGGCCCTGCCCGAC
CCGGACTTCGCGTCGAAGTCGGTGGGCCGGGATCCGGCCACCGAGGTCGAGCGGATCCTG
TGCCGGGTGTTCGCCGAGGTCCTCGGCCTGGAACGGGTCGGGGTCGAGGCCGGCTTCTTC
GAACTGGGCGGGGACTCCATCTCCTCGATGCAGGTGGCCGCCCGCGCCCGCCGTGAGGGA
ATCGCCCTCACCCCCCGGCAGGTGTTCGAGCAGCGGACCCCCGAACGACTGGCGCGAGTG
GCGGGAACGACGCGGTCGGGCCGCTTCGAGGCGGACGCGGGCATCGGGGAGATTCCCTGG
ACGCCGGTGATGCGCGCCCTCGGAGCCGACGCGCAGCGCCCCGGCTTCGCCCAGGCGCGG
GTCGTGGTCGCCCCGCCCGGCCTCGACCGGAGCGCGTTGGTGGCGGCCCTGCAAGCGGTG
CTGGACACCCATGACCAGCTGCGCGGCCGGGTGGAGTCCGACGGACGGCTGATCGTGCCC
GGTCGCGGCACGGTGGACGCGGCCGGACTGGTGACACGGGTGGCGGCCGCGACCGCGAAC
CTCGACGAGATCGCCGGACGCGAGGCCGGGACGGCCGCGGGCGTCCTGGACCCGTCGACG
GGAACCATGGTGCGGGTCGTGTGGATCGATGCCGGAGACGCCGAGCCGGGCCGGCTGGCG
CTGGTGGCGCATCACCTGGTGGTCGACGCGGTCTCGTGGGGCATCCTGCTGCCGGATCTG
CGGACAGCCTATGAACAGGTGATCTCCGGAGGGACCGCGTCTCTCGAACCTGCGACGACG
TCGTTCCGGCAGTGGGCGAGGCGGCTGACCGAGCAGGCGCTCAGCGAGCGTACCGTCGCC
GAGATCGATCACTGGGTCGGGGTCCTCGACGGCGCGGACCCGTTCCCCGAGGAGCACGCC
GGGCGGCCGCACTCGTGGTCCTGGACACTGTCCGGATCCGCGGCGCGGAGCCTGGTGGGT
CAGGCCCCGGGAGCCTTCCACTGCGGGGTCCAGGAGGTGCTGCTGGCGGGCCTGGCCGGC
GCGGTGGCGCGCCTGCGCGGTGGTGACGCCGGGGTGCTGGTGGACCTGGAGGGCCACGGC
CGCCACGCGGCCGACGGCGAGGACCTGCTGCGCACCGTGGGCTGGTTCACCAGCGTCCAC
CCGGTCCGCCTCGAAGTCTCCGGCCTCGACCTGGCGGCCGCGGCGGCCGGGAACGCGGCG
GCCGGGGAGCTGCTGAAGGCCGTGAAGGAGCAGGTCCGCGCCGTTCCGGGCGACGGGTTC
GGCTACGGACTGCTGCGCCACCTCAACCCCGACACCGGGGCCAGGCTGGCCGAACTGCCG
TCCCCGAGAATCGGGTTCAACTATCTCGGCCGGTCGGCCGCCGCCTCCCCGGACACCCCG
TGGCAGGTCGTCGAAGGGCCGCTCGGTGCGGGAGCCGACGCCCCCGACCTGGTCCTCGCC
CATGCGCTGGAGGTCGGCGCGAGGGTGCAGGACACGCCGGGCGGTCCCCAGGTGAGGCTC
ACCGTGGACGGCCGGGATCTCGACCCCGACACGGTGGAGCGGCTGGGGGAGGCCTGGCTG
GAGATGCTCACCGGCCTCGCCGCCCACGCCGCCGATCCCGGCGCCGGAGGCCACACGCCG
TCCGATTTCGACCTCGTCGACATGTCGCAGCGGGACGTGGCGGAGCTGGAGGCCGCCGCG
CCCGGGCTGACCGACATCTGGCCCCTGTCGCCCCTGCAGGAAGGCATGCTCTTCGAGCGG
GCCCTCGACGAGGAGGGCGTGGACGTCTACCAGAGCCAGCGGATCCTGGAGCTGGACGGG
CCGCTCGACCCGGAACGGCTGCGCGCGGCGTGGCAGCCGCTGGTCGCCCGGCACGAGTCG
CTCCGGACGAGCTTCCACCAGCTCGGCTCGGGTGAGACGGTGCAGGTCGTCGTGGGCGAG
GCCGACATCCCCTGGCGTGAGGCGGACGTGTCACATCTCGGCGAGGCCGACGCGGCCGCC
GAGGTCGAACGTCTTCTCGCGGAGGACCAGGCGGAGCGGTTCGACGTGACCCGCCCGCCG
CTGCTCCGGCTGCTGCTGATCCGTCTCGGCGAGAACAGGCACCGGCTCGTCCTGACGTCG
CACCATGTCCTCCTGGACGGCTGGTCCACGCCGATCATCCTGGGCGAGATGTCCTCCGGC
TACGCCGGCGGACCGGGCCCGTCGACGTCACCCTCCTACCGTGACTACCTGCTGTGGCTG
AGCCGTCAGGAGCAGGACGCGACGCTGTCGGCCTGGCGGTCGGAGTTCGCCGGGTCCGAC
GAGCCGACCGTGGTGGACGCCGACGCGGGCAGGGCGATGGTGATGCCGCAGGAGCATTGC
GCGTGGCTGTCCGCCGAATCGACCCGGACGCTCACCGACTTCGCCCGCGGCCACGGGCTG
ACGCTGAGCACGATCGTGCAGGGCGCGTGGGCCCTGGTGCTGGCCCGGCTGGCGGGCCGG
ACGGACGTGGCGTTCGGCACGGTGGTGTCGGGCCGCCCGGCGGACGTACCGGACGTGGAG
CGGATGGTGGGGATGTTCATCAACACCGTTCCGGTCCGGGTGCGCCTCGACGGCGGCCTG
CGGGTCCTGGAGCTGCTCCAGGATCTGCAGCGACGCCAGGCGGCGTTGACGGAACACCAG
TACATGGGTCTGTCGGAGATCCAGAAGGCGGTGGGACCGGGCGCGGTCTTCGACACCATC
ATGATGGTGGAGAACTACCCGCTCGACGCGGCCGGCCTCGGCGACGACGGCGGTGTCACG
ATCAGCTCGGCCGTCACCCGGACCGGTACCGGCTACCCGCTGACCATGAGCGCCAGTCCC
GGAGAGCGCCTGCAGATCCGCGTGTCCTTCCGGCCCGACCGGATCGACGAGAGGACCGCC
GCCGAGGTCGCCGGGCAGGTTGTGCGTGTCATCGAGCGGGTGGCGGCCGAGCCCTCGCTC
CCCGTGGGGCGCCTGGGTGTGACGAGTGACGCGACACGCACGTCCGAGGTGGAGCGCTGG
AACGCGACCGGCGAGGCCGCCGGCGGTGCGTCGGTGGTGGAACTCTTCCGGCGGCGCTCG
GCAGGCACGCCGGACGCGGTGGCCGTCGTCGACGGCGACCGCACCCTGTCCTACGGCGAC
CTCGACCGGGAGTCGGACCGGCTGGCAGGGCGTCTGGCCGAGACGGGCGTGCGCCGCGGC
GACCACGTCGGCGTGGTGCTGGAGCGCGGCGCGGACCTGTTCGTCGCATTCCTCGCGGTC
TGGAAGGCCGGCGCCGCCTACGTCCCGGTGCATGTGGACTACCCGCCGGTTCGGATCGAG
CGGATGCTGGCCGACGCCGGCGTGACGGTGGCGGTCTGCGCCGAGGGGACCCGGAACGCG
GTGCCGGACGGGCTCGAGCCCGTGCCCGTGGACGCGCCGTGGGCCGGGGAAACGAGGCAC
GAGACGCCGACGGTCACGGCGCGCGACGCCGCCTACGTGATGTACACGTCGGGATCGACC
GGGGAGCCCAAGGGCATCGTGGTGCCGCACGGAAGCGTCGCGGCCCTGGCCGGCGACCCC
GGCTGGGCACTCGATGCCGACGACTGCGTCCTGATGCACGCCTCGCACGCGTTCGACGCG
TCGCTGTTCGAGATCTGGGCGCCGCTGGTCCGCGGTGCCCGCGTCATGGTCGCCGAGCCG
GGCGCGGTCGACACGCAGCGCCTGCGGGAGGCGGTCGCACGCGGCGTGACCACCGTCCAT
CTGACGGCCGGGAGCTTCCGGGTGCTGGCCGAGGAGTCGCCGGGCTCCTTCGACGGGTTG
CGCGAGATCCTCACCGGCGGAGACGTGGTGCCCCTCGCCTCCGTCGCACAGCTGCGCCGG
GCCTGCCCGGACGTCCGGGTCCGGCACCTTTACGGCCCGACCGAGACCACACTGTGCGGC
ACCTGGCATCTCCTCGAGCCGGGGGACGAGCCGGGCGACGTCCTGCCGATCGGCCGCCCT
CTGGCCGGGCGGCGGGCGTACGTGCTCGACGCCTTCCTCCAGCCGGTCGCCCCGAACGTG
ACCGGTGAGCTCTACCTCGCCGGCGTAGGTCTGGCGCTCGGCTATCTCGGGGCCCGCGGC
GCCACCTCGGAGCGGTTCGTCGCCGACCCGTTCGTCCCCGGCGAGCGAATGTACCGCACC
GGCGACCTGGCACGCCGGAACGACCGGGGCGAGCTGTTGTTCGCCGGACGGGCCGACGCC
CAGGTGAAGATCCGGGGCTACCGGGTCGAGCCGACGGAGATCGAGACGGTGCTCGCCGAG
GCTCCCCAGGTCGCGCAGACGGTCGTCGTCGCGAGGGAGGACGGTCCGGGTGAGAAGCGG
CTGATCGCCTATGCGATCGCGGAACCGGACCAGGTCCTGGACCCCGAAGCGCTCCGCGAA
CACCTCGCGGCGCGGCTGCCCGAGTTCATGGTCCCGGCCGCGGTGGTGGTCCTGGACGAC
TTCCCGCTGACGATCAACGGGAAGATCGATCGCGAGGCCCTGCCCGCTCCCGAGTTCTCC
GCGAAGCCCGCCGGCCGCGAGCCGCGCACCGAGGCGGAGCGGGTGCTGTGCGCACTGTTC
GCCGAGATCCTCGGGCTGGACCGGGTCGGGGCCGACGACAGCTTCTTCGAACTGGGCGGC
GACTCGATCCTCTCCATGCAACTGGCAGCCCGGGCCCGCCGCGCCGACGTCGTCTTCGGC
GCGAAGGACGTCTTCGAGCAGGAGACACCCGCGGCCATCGCGGCGGTCGCCGAGCGCGGC
GGCGCCCCGCGGGCAGAGCTCGCCGACGACGTCGGCGAGGTCGCGTGGACGCCGGTGATG
CGGGCGCTCATCGAACGCGACCCCGGCGCGCTGACCGGCGGGGCCCTGACCCAGTGGGTG
ACCGTGGGCGCTCCCGGCGACCTGTCGGTGGACGCGCTGGCGGCCGGGCTGGGCGCGGTG
ATCGGCACCCACGATCTGCTGCGGAGCCGGATCGTCACGGCCGCGGGCGAGGAGCCGGGC
ATGGTCGTGTCCGCTCGGAGTGCGGTGGACGCGGCCGGTCTGGTCGAGCGGGTCGACGCG
GACACCGGCGACATCGACGAGATCGCGGACCGGTGCGCCAGGGAGGCGGCGGCGAGGTTG
GATCCCGCTGCCGGTGTGATGATCCGGGCGGTGTGGGTGGACGCCGGACCCGGCCGTGTG
GGTCGGATCGTGCTGGTGGCGCACCATCTGGTGGCCGACGCGGTGTCGTGGCAGATCCTG
CTGCTGGACCTGCGTGCGGCATGTGAGGCCGTGAGCGCGGGCGCGGAGCCCGCTCTCGAC
CCGGTGGAGGTCCCGTTCCGGCGCTGGGCGCGGACACTGGCCGATCAGGCCGCGGTCCGG
GCCGCGGAACTCGGGACCTGGACGGAGATCCTCGACCAGGCGGAACCGCGGCTGGCCTCC
CTCGACCCCGCGCGCGACACCATCGCGACCGCGGGACGCCGGTCCTGGACCCTGCCGCGA
GACCGGGCGGGCGTGCTCGTGGGGAAGGCCGCCTCGGCCTACCACTGCGGTGTCCACGAG
GTGCTCCTGGCCACGCTGGCGGGCGCGGTCACCCGGTGGCGCGGTGGCGACGCCGTCGTG
GTGGACGTCGAAGGCCATGGCCGCCGGCCCGTCGGAGAGCTGGACCTCTCGCGGACGGTC
GGCTGGTTCACCGACATCCACCCGGTCCGGCTGGACGTGACCGGGATAGACACCGACGAG
GTGATCGCCGGTGGCGAGGCGGCCGGCCGCCTGCTGAAGGCGGTCAAGGAGAACGTGCGC
ACCGTCCCCGACGGTGGCCTCGGCTACGGTGTGCTGCGCCACCTGAACGCGGAGACGGCA
CCGGTCCTGGCGGCGTTGCCGAAGGCGGAGATCGGGTTCAACTACCTGGGCCGCTTCTCC
TCCCGCCCCGAGGGAGATCCGGAGCCCTGGCAGATGACGGGGACCATCGGCGGCGCCGCG
GAGGAGCACGCGCCGTTGCGCCACGCCGTGGAGGTCGACGCCGTCGTCCTCGACTCCCCG
GACGGACCCGAGCTCCGGCTGACCCTGACCTGGGCCGGACGGATCCTCGGCGAAGCCGAG
GCGGAGTCGCTCGGCCGGGCCTGGCTGGACCTGCTGTCCGGACTCGCCGCGCACGCCGCC
CTCGGAGCCGGTGGGCACACCCCCTGCGACTTCTCCCTCACCGCGCTGACGCAGCAGGAC
GTGGAGGAGATCGAGGCCGCCGTTCCGGGACTCGCCGACATCTGGCCGCTCTCCCCGCTC
CAGGAGGGACTGCTGTTCCACGCCGTCGACGAGCGAGGCCCGGATGTGTACGCGGGTATC
CGCACCCTCGCCCTCGACGGCCCGCTGGACGTCGCTCGCTTCCGGGCGTCCTGGCAGACC
CTCCTCGACAGGCACGCCGCGCTGCGGGCGAGTTTCCACCAGCTCGGGTCCGGCCAGGCC
GTGCAGGCGATCGCAGGTGAGGTGGTGTTGCCCTGGACAGAGACCGACCTGTCGCACCTG
CCCGAGGACGAGGCGCTGGCGGAGGCCGAGCGACTCGCGGAGGAACTGCATGCCGACCGG
TTCGAACTGGATCGGGCCCCGCTGTTGCGCCTGCACCTGATGCGCATCAGCGAACGCAGC
CACCGGCTGGCCCTCGCCTCCCACCACATCTCCTGCGACGGATGGTCCCTGCCGATCCTG
TCCGGCGACGTGACGGCGGCCTACGAATCGGGCGGCGACGGCCGGTCCCTGCCCGCCCCG
ACGTCGTACCGCAGCTATCTCGCCTGGCTCGCCCGCCAGGACAAGGAAGCCGCCCGGCAG
GCGTGGCGGAGCGAGCTCGCCGGGCTCGACGAGCCCACTCACGTCGTGCCGCCGGACGCC
GTCACCGCGCCCGTCGAGCCCGAGCGACTCCGGTTCGACATGGACGAGGACCTGAGCCGC
CGGCTGGTGGAGTTCACCCGCCGGCACGGCGTCACGATGAACACCCTCTTCCAGGGAATC
TGGGCGCTGCTCCTGGCCCGGCTGACGGGCCGGGACGACGTGGTCTTCGGCTCCGCGGTG
GCCGGGCGGCCGCCCGAGATTCCCGGCGTCGAGTCCGTGGTGGGCCTGTTCATGAACACG
CTGCCGGTCCGGGCCCGCCTCGACGGCGGTGAACCGTTCCTCGACATGCTGACGCGGCTG
CAGGAGCGTCAGGTCGCGATGATGGCGCATCAGCACGTCGGGCTGTCGGAGATCAAGCAA
CTCGCCGGGCAGGGCGCCGCGTTCGACACCATCGTGGTGTTCGAGAACTACCCCCGCCCG
CCGCTCCCGTCCGAGGACCCCGATGCGCTCGTCATGCGCCCCGCGGGGATCCCGAACGAC
AGCGGGCACTACCCGATATCCATGCGCGCCTCCCACGACGGCGGCGTCCACGGCGAGTTC
ATCTACCGTCCGGACGTCTTCGACCGGACCCGGGCGGAGGAGATGCTGGCGGCGGTCGTC
CGGGCACTGGAGCAGGTGGCGGCCGATCCGTGGACCTTGGTGGGCCGGGTCGGCCTGATC
GGCCCGACGGAGCGCGGCCTGGTGGTCGAGGAGTGGAACGCCACCGATGCGCCCTTCGTG
CCGGAGCCGCTGCCCGTACTGTTCCGCCGCCGGGCGGAACTCTCGCGGGACGCGATCGCG
GTGGAGGACGCGGATCGGAAGCTGTCGTACGGGGGGCTGCTGGAAGAGGCAGAGGATCTG
GCGCGGCTGCTGGCGGGGCTGGGCGTCCGGCGGGAAACGCGCGTGGGTGTGCTGGTCGGA
CGGTCGGCGGAGCTGGTGGTGGCCCTGCTCGGCGTGTCGCTGTCGGGCGGGGTGTTCGTA
CCGGTCGACCCGGAGTATCCCGCCGGACGGATCGAGCTGATGCTGACGGATTCCGCCCCC
GAGGTGCTGCTGTGCACGAAGGCGACCCGGACAGCCGTGCCGGACGGGTTCGCGGGCGTC
GTGGTCGTACTGGACGAGCGGTCCGCCGCCGACCCGGGTGCGGCGCTGCCGGCCGTGGCG
GTGGGCGACGGAGCGTATGTGATCTACACCTCCGGGTCCACGGGTACGCCCAAGGGCGTC
CAAGTCACCCATGCCGGGCTCGGCAACCTGGCCGGCGCGCAGATCGAGCGCTTCGGCGTG
ACATCCTCCTCACGCGTCCTGCAGTTCGCGTCCCTCGGGTTCGACGCCGCGATCTCCGAG
TTGTGCATGGCCCTGCTGTCAGGCGGGACCGTGGTGCTGGCCGACCCCGACAGCATGCCG
CCGCGAGTGTCGCTGGGCGACGCGGTGCGCCGGTGGCGCATCACCCACGTCACTGTGCCG
CCGAGCGTGCTGGCCGTCGAGGAGGACCTGCCGGACAGCCTCGAGACACTGGTGGTCGCC
GGTGAGGCGTGCCCGCCCGCTCTGGTCGACCGCTGGTCGGGGGACCGCCGGATGATCAAC
GGTTACGGGCCCACCGAGACCACCGTGTGCGTGACGATGAGCGCACCGTTGTCTCCGGGA
CGCGACGCGCCCCCCATCGGCCGCCCGATCGCCAACATGCGGGCGTACGTGCTCGACGCC
TTCCTGCAGCCGGTGCCGCCCGGCGTGGCCGGTGAGCTCTACGTCACCGGGGCAGGGCTC
GCGCGCGGGTACCTCGGACGTCCGGGCCTGACCGCGGAGCGGTTCGTCGCCGACCCGTTC
TCCTCCGGGGGCCGGATGTACCGCACCGGCGACCGGGCCCGCTGGACCCGGGAGGGAGAG
CTGGTCTTCGTCGGCCGGGCCGACGCGCAGGTCAAGGTGCGCGGTTACCGGGTCGAGCCG
GGTGAGATCGAGGCCGTGCTGTCGGACCATCCGGGAGCCGCCCAGGTGGTGATCGTCGCT
CGTGAGGACGGCCCCGGCGAGAAGCGGCTGGTGGCGTACGTCGTGCCGGCGGCCGCGCAG
CCGGCCGACGAACTGATCGCAGCTCTCCGCGAGACCGCGGCCGAACGCCTGCCCGAGCAC
ATGAGGCCGGTGGCGTTCGTACCGCTGGACGCGGTGCCCCTGACCCCGAACGGAAAGGTC
GATCACCGGGCACTCCAGGCCCCCGACCTCGCCGGGAACTCCTCCGGACGGGGTCCGCGC
ACGGCCGTCGAGGAGCTGTTGTGCGCGGTGTTCGCCGAGATCCTCGGGGTGGAACGGGTC
GGAGTCGACGACAGCTTCTTCGAGATCGGCGGCGACTCGATCAGCTCGATGCAGCTGTCG
GCCCGGCTCCGCCGCGAAGGGCTGGAAGTGACCCCCTGGCAAGTGTTCGAGGAGAAGACG
CCCGAACGGCTGGCGGCGCTCGCCAAGGAGCTCCCGGCCGAGGGCGAGGAGAGCTCGGAG
CCGGAGTCCGACGACGGCATGCTCCTGGCTCTCTCGCCCGACCAGATGGACCAACTCCAA
AGCGGGCCGACCGATGGATGA
[4] C7..301
[4] A481..878
[4] L-4-hydroxyphenylglycine(Hpg)648..748
[4] PCP956..1022
[4] E1056..1496
[5] C1505..1796
[5] A1977..2369
[5] L-4-hydroxyphenylglycine(Hpg)2139..2239
[5] PCP2452..2518
[5] E2560..3004
[6] C3013..3307
[6] A3489..3877
[6] tyrosine3655..3750
[6] PCP3963..4029
[4] C19..903
[4] A1441..2634
[4] L-4-hydroxyphenylglycine(Hpg)1942..2244
[4] PCP2866..3066
[4] E3166..4488
[5] C4513..5388
[5] A5929..7107
[5] L-4-hydroxyphenylglycine(Hpg)6415..6717
[5] PCP7354..7554
[5] E7678..9012
[6] C9037..9921
[6] A10465..11631
[6] tyrosine10963..11250
[6] PCP11887..12087

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [481-878]  1.20000000000001e-112 PF00501 [1977-2369]  2.59999999999995e-99 PF00501 [3489-3877]  7.40000000000007e-110 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [7-301]  4.89999999999996e-69 PF00668 [1056-1326]  2.7e-30 PF00668 [1505-1796]  1.5e-67 PF00668 [2560-2833]  1.40000000000001e-33 PF00668 [3013-3307]  1.6e-60 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [981-996]  PS00012 [2477-2492]  PS00012 [3988-4003]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [949-1024]  5.99999999999995e-76 G3DSA:1.10.1200.10 [2442-2519]  5.99999999999995e-76 G3DSA:1.10.1200.10 [3955-4030]  5.99999999999995e-76 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [949-1023]  4.60000044330862e-17 SSF47336 [2445-2519]  7.60000011115812e-18 SSF47336 [3956-4030]  3.0999994589937e-18 SSF47336
SSF47336   ACP_like
 [960-1019]  1.3e-11 PF00550 [2455-2515]  1.3e-11 PF00550 [3966-4027]  2.5e-12 PF00550
PF00550   PP-binding
 [956-1022]  PS50075 [2452-2518]  PS50075 [3963-4029]  PS50075
PS50075   ACP_DOMAIN
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1341-1496]  9e-34 TIGR01720 [2848-3004]  9.69999999999989e-38 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [481-878]  2.39999999999997e-128 TIGR01733 [1977-2369]  2.09999999999996e-120 TIGR01733 [3489-3877]  2.70000000000002e-126 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [957-1025]  6.20000124972815e-09 SM00823 [2453-2521]  6.20000124972815e-07 SM00823 [3964-4032]  3.89999861795218e-09 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [602-613]  PS00455 [2093-2104]  PS00455 [3607-3618]  PS00455
PS00455   AMP_BINDING
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [72-163]  5.10000000000001e-14 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP No significant hit
TMHMM No significant hit