close all open/close all

CDS information : A4793_00120


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction35,243 / 30,768 / - [in whole cluster]
35,243 / 30,768 / - [in contig]
Locationcomplement(30768..35243) [in whole cluster]
complement(30768..35243) [in contig]
TypeCDS
Length4,476 bp (1,491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)StaB
GenestaB
ORF22
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • peptide synthetase (module 3)
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)

close this sectionPKS/NRPS Module

A3 L-3,5-dihydroxyphenylglycine(Dpg)
C15..310
A489..879
PCP955..1021
e1057..1483

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [StaB]
MTATTTSPGSALAEIWPLSPMQEGMLYHSSFDDAAPDIYVIQQTQIIDQPLDTERLRTSW
QALLDRHPTLRASFHRRKSGETVQLIARDVQLPWTERDLSGLSEDDAMAEVSVIAQKERA
RGFDLTRPPLLRLTLIRLGAKRHCLVTTSHHLLMDGWSRAILESELLEIYAAGGVVSGLR
SAASYRNHLAWLGRQDKDAARAAWRAELAGADGSSALSISERPGRAPELPVREVIRHSPA
STSALTEFARGHGLTMNTVVQGAWALVLARLARRQDVMFGATVSGRPADLPGVEGMVGLF
INTVPVRVRLDGGRTVMETLTELQERQSTLIAHQHLGLPEIQKLGGAGLDTLVVFENYVD
PAVGSKSPRALGLTLQEFHQASPYAITLGVMPGESIEIELQYQPEIVDAGVAEAALHGLV
RVLDQMIAEPGAPVGRLTLLGDAERERVVERWNETGDPIAAPSAVDLFLRQVERAPDATA
MTAGGRSWSFAELDEWSGRLARVLKDRGVRRGDRVGVLLERSPDVVAAWLGVWKAGAAFV
PVDPDYPADRVAFMMSDAAVAAVVCGAGTAAVVPSGHVLVTMDDAVDGETSLVPVGADDL
AYVMYTSGSTGTPKGVAVAHGGVAALAGDPGWGVGAGDTVLMHAPHTFDASLYDLWVPLV
SGARVLLAEPGVVDAERLAAHVAEGLTSVNFTAGQFRALVQESPESFSGLRDVLAGGDVV
PLGEVERVRRACPELVVWHTYGPTETTLCATWKAIEPSDRLGSVLPIGRPLPGRRLYVLD
VFLRPLPPGVEGDLYIAGAGVAHGYLDRPGLTAERFVADPFASGERMYRTGDVAYWTDEG
ELVYAGRADNQVKIRGYRVEPGEIEAVLAERPGVDQAVVVAREGRLIGYVVSGGDVDPEG
LREDVARALPGYMVPAAVLVLDALPVTANGKVDRAALPDPDFGGRVTGREPVTDAERALC
ALFAEVLDLDRVGADDSFFELGGDSITSMQLAARARRAGMVFGAREVFEHRTPAGIAGIL
DLDGGSAEPPEDTGDVARTPMTKVWGPGAARWVTVGAPGDLSVDTLAAGLSVVIDAHDML
RSRTVGAGTPRMVVSGRGAVDAAHLIERVEADTGDLDDVAERCAREAAGRLDPAAGVMVR
AVWVDAGPGRVGRLVLVAHPAVVDARSWEILLRDLRAACEAVAAGREPSVDPVDVSFRRW
AAALAEQATSAERVAELTGWTALLDGEEPRLGEPGTGSPAGRRSWTLPKDRAGALAEQVT
SAFHCGVHEVLLTGLAGAVARWRGGHVVLVDVEDHGRHPVGGMDPSRTVGRFTSVHPVRL
DVGGIDPASGSLLKAVKEQSRAVPGDGLGYGLLRHLNGETGPVLEASPSPRIGFVYLGRS
ATAEVREWQRSGGIGHSSDPDMRPSHALEAEAAVRETPDGLELTLTVAWPAGLFPEAEVE
RFGRLWLDELSALARLVSDSSAGGHTASDFDLLDLNQDEIEELEAEFDDDL
selected fasta
>non-ribosomal peptide synthetase [StaB]
GTGACCGCAACGACTACGTCTCCTGGATCGGCGCTCGCCGAGATCTGGCCGCTGTCCCCG
ATGCAGGAGGGAATGCTCTACCACTCCTCCTTCGACGACGCGGCCCCCGACATCTACGTC
ATCCAGCAGACCCAGATCATCGACCAGCCGCTGGACACCGAGCGGCTCCGGACGTCTTGG
CAGGCCCTCCTCGACCGGCACCCGACGCTCCGGGCGTCCTTCCACCGACGGAAGTCCGGC
GAGACGGTCCAGCTCATTGCTCGGGATGTCCAACTTCCCTGGACAGAGCGCGACTTGTCC
GGCCTGAGCGAGGACGACGCGATGGCCGAGGTCAGCGTGATCGCGCAGAAGGAGCGCGCC
AGGGGGTTCGACCTGACGCGGCCTCCGCTGCTGCGGCTGACGCTCATCCGGCTCGGTGCG
AAGCGGCACTGTCTCGTGACGACGAGCCACCACCTGCTCATGGACGGGTGGTCGCGGGCG
ATCCTCGAGTCCGAACTCCTCGAGATCTACGCGGCCGGCGGAGTCGTGTCGGGTCTGCGG
TCGGCGGCCTCCTACCGGAACCATCTGGCATGGCTGGGGAGGCAGGACAAGGACGCCGCC
CGGGCGGCATGGCGCGCGGAACTGGCCGGTGCCGACGGATCATCGGCGCTCAGCATCTCC
GAACGGCCCGGCCGGGCACCGGAACTGCCGGTCCGGGAGGTGATCCGCCATTCACCGGCC
TCCACCTCCGCCCTGACGGAGTTCGCCCGCGGCCATGGGCTGACGATGAACACGGTGGTG
CAGGGGGCGTGGGCGCTGGTGCTGGCCCGACTGGCGCGCCGCCAGGACGTGATGTTCGGC
GCGACGGTCTCCGGGCGCCCGGCGGACCTGCCGGGCGTGGAGGGCATGGTGGGGCTGTTC
ATCAACACCGTGCCGGTGCGCGTGCGGCTGGACGGCGGCAGAACGGTCATGGAGACGCTG
ACGGAGCTGCAGGAGCGGCAGTCCACGCTGATCGCGCACCAGCATCTCGGGCTCCCGGAG
ATCCAGAAGCTCGGCGGGGCGGGTCTGGACACGCTCGTGGTGTTCGAGAACTACGTCGAT
CCCGCGGTGGGCTCGAAGTCCCCGCGCGCTCTCGGCCTCACCCTGCAAGAGTTCCACCAG
GCGTCCCCCTACGCGATCACTCTGGGCGTCATGCCGGGTGAGAGCATCGAGATCGAACTG
CAGTACCAGCCGGAGATCGTCGACGCCGGAGTCGCCGAGGCCGCTCTCCACGGGCTCGTC
CGCGTCCTGGACCAGATGATCGCGGAGCCGGGCGCGCCGGTGGGCCGCCTGACCCTGCTG
GGCGACGCCGAACGCGAGCGGGTGGTCGAGCGGTGGAACGAGACGGGCGACCCGATCGCC
GCGCCGTCGGCGGTGGATCTCTTCCTCCGGCAGGTGGAGAGGGCCCCGGACGCGACGGCG
ATGACGGCCGGGGGACGAAGCTGGTCGTTCGCGGAGCTCGACGAGTGGTCGGGCCGGCTG
GCGCGGGTACTGAAGGACCGGGGCGTGCGACGTGGTGACCGCGTCGGTGTCCTGCTGGAG
CGTTCGCCGGACGTAGTGGCGGCATGGCTCGGGGTGTGGAAGGCGGGAGCGGCGTTCGTG
CCCGTCGACCCGGACTACCCGGCGGACCGGGTCGCGTTCATGATGTCCGACGCCGCGGTC
GCCGCCGTGGTGTGCGGTGCGGGGACCGCGGCCGTTGTGCCCTCGGGCCACGTGCTCGTC
ACGATGGACGATGCCGTCGACGGTGAGACCTCGCTGGTCCCGGTCGGGGCGGACGACCTG
GCGTACGTGATGTACACCTCGGGATCGACCGGGACACCCAAGGGCGTCGCCGTCGCGCAC
GGCGGCGTCGCGGCCCTCGCGGGAGACCCGGGGTGGGGCGTCGGAGCGGGCGACACCGTG
CTGATGCACGCGCCGCACACCTTCGACGCGTCCCTGTACGACCTCTGGGTGCCGCTCGTG
TCGGGTGCGCGGGTGCTGCTCGCCGAGCCGGGCGTGGTCGACGCGGAGCGCCTCGCCGCT
CATGTCGCAGAGGGCCTGACCTCCGTGAACTTCACGGCGGGTCAGTTCCGGGCGCTGGTC
CAGGAGTCGCCGGAGTCGTTCTCGGGGCTGCGCGATGTGCTGGCGGGCGGCGACGTGGTG
CCGCTCGGTGAGGTGGAGCGGGTCCGGCGGGCCTGCCCCGAGCTGGTCGTCTGGCACACG
TACGGCCCGACGGAGACCACCCTGTGTGCGACCTGGAAGGCGATCGAGCCCAGCGACCGG
CTGGGATCGGTCCTGCCGATCGGCCGCCCACTGCCGGGCCGGCGGCTGTACGTGCTGGAT
GTCTTCCTGCGTCCGTTGCCGCCGGGCGTCGAGGGCGATCTCTACATCGCGGGCGCGGGG
GTGGCGCACGGCTATCTGGACCGTCCCGGGCTGACGGCGGAACGGTTCGTCGCGGACCCG
TTCGCCTCCGGTGAGCGCATGTACCGGACGGGCGACGTCGCGTACTGGACGGACGAGGGC
GAGCTGGTGTACGCCGGGCGCGCCGACAACCAGGTGAAGATCCGCGGCTACCGTGTGGAG
CCGGGCGAGATCGAGGCGGTGCTGGCTGAGCGGCCGGGCGTCGACCAGGCCGTGGTGGTG
GCACGTGAAGGACGCCTGATCGGCTATGTCGTGTCCGGCGGCGACGTCGACCCGGAAGGG
CTGCGCGAGGACGTCGCCAGGGCGCTGCCCGGCTACATGGTGCCGGCGGCGGTGCTGGTC
CTCGACGCGCTGCCGGTGACGGCCAACGGCAAGGTGGACCGGGCGGCGCTGCCGGACCCC
GACTTCGGCGGACGCGTCACCGGCCGGGAACCGGTCACCGACGCCGAGCGGGCGCTGTGC
GCGCTGTTCGCCGAGGTTCTCGACCTGGATCGGGTCGGCGCGGATGACAGCTTCTTCGAG
TTGGGCGGGGACTCCATCACCTCGATGCAGCTGGCGGCGCGGGCCCGCCGCGCCGGAATG
GTCTTCGGCGCGCGTGAGGTGTTCGAGCACAGGACCCCGGCGGGAATCGCCGGGATCCTC
GACCTGGACGGCGGGTCGGCCGAACCGCCCGAGGACACGGGAGACGTCGCCCGGACGCCG
ATGACGAAGGTCTGGGGGCCGGGGGCCGCGCGGTGGGTGACCGTCGGCGCGCCCGGTGAC
CTGTCGGTGGACACGCTGGCGGCCGGGCTGAGCGTGGTGATCGACGCCCACGACATGTTG
CGGAGCCGGACCGTCGGGGCCGGGACGCCCCGGATGGTCGTGTCCGGCAGGGGCGCGGTG
GACGCCGCGCATCTGATCGAGCGGGTCGAGGCGGACACCGGTGACCTCGACGACGTCGCG
GAGCGGTGCGCTCGGGAGGCGGCCGGTCGGCTGGATCCTGCCGCGGGCGTGATGGTCCGT
GCGGTGTGGGTGGACGCGGGACCCGGTCGTGTCGGACGGCTCGTGCTGGTGGCGCACCCC
GCGGTGGTCGACGCGAGGTCGTGGGAGATCCTGCTGCGCGACCTGAGGGCTGCCTGTGAG
GCGGTCGCCGCGGGCAGGGAGCCGTCCGTCGACCCGGTGGACGTCTCGTTCCGGCGATGG
GCGGCCGCATTGGCGGAGCAGGCGACCTCCGCGGAACGCGTCGCGGAACTGACCGGGTGG
ACGGCGCTCCTCGACGGAGAGGAGCCACGGCTGGGCGAGCCCGGCACCGGCTCGCCCGCG
GGACGCCGATCATGGACCTTGCCGAAGGACCGCGCCGGTGCGCTCGCGGAGCAGGTCACC
TCGGCCTTCCACTGTGGTGTCCACGAGGTGCTGCTCACGGGCCTGGCGGGCGCGGTGGCG
CGTTGGCGAGGAGGCCACGTGGTGCTGGTGGACGTGGAGGACCACGGCCGTCATCCGGTG
GGCGGGATGGATCCGTCCCGGACGGTGGGCCGGTTCACGAGCGTGCATCCGGTGCGGCTG
GACGTGGGCGGGATCGACCCGGCGTCCGGGTCGTTGCTGAAGGCGGTGAAGGAGCAGTCG
AGGGCGGTGCCCGGCGACGGGCTCGGCTATGGGTTGCTGCGCCATCTGAACGGCGAAACG
GGACCGGTGCTGGAAGCCTCGCCTTCGCCTCGGATCGGGTTCGTCTACCTGGGCCGGTCC
GCCACGGCCGAGGTGCGGGAGTGGCAGCGGTCCGGAGGGATCGGCCATTCGTCGGACCCG
GACATGAGGCCGTCACACGCCCTGGAGGCGGAGGCGGCCGTCCGGGAAACGCCGGACGGC
CTGGAACTGACGCTCACGGTGGCCTGGCCGGCCGGACTCTTCCCGGAGGCCGAGGTCGAA
CGCTTCGGCCGGCTGTGGCTGGACGAGTTGTCCGCCCTGGCCCGTCTGGTGAGTGACTCT
TCCGCCGGTGGGCACACCGCGTCCGATTTCGACCTCCTCGACCTGAACCAGGACGAGATC
GAGGAACTCGAAGCCGAGTTCGACGACGACCTTTAA
[3] C15..310
[3] A489..879
[3] L-3,5-dihydroxyphenylglycine(Dpg)649..749
[3] PCP955..1021
[3] e1057..1483
[3] C43..930
[3] A1465..2637
[3] L-3,5-dihydroxyphenylglycine(Dpg)1945..2247
[3] PCP2863..3063
[3] e3169..4449

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [489-879]  1.39999999999997e-108 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [15-310]  1.29999999999998e-60 PF00668 [1057-1322]  7.7e-25 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [980-995]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [955-1021]  PS50075
PS50075   ACP_DOMAIN
 [948-1021]  2.1e-23 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [948-1020]  4.09999599045784e-18 SSF47336
SSF47336   ACP_like
 [958-1018]  1.9e-12 PF00550
PF00550   PP-binding
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1330-1483]  1.6e-33 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [489-879]  1.10000000000001e-125 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [603-614]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit