close all open/close all

CDS information : A4793_00140


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction43,398 / 41,455 / - [in whole cluster]
43,398 / 41,455 / - [in contig]
Locationcomplement(41455..43398) [in whole cluster]
complement(41455..43398) [in contig]
TypeCDS
Length1,944 bp (647 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)StaU
GenestaU
ORF20
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ABC transporter
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q799B1
NITE
Balhi_00060
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17823795] The ABC transporter Tba of Amycolatopsis balhimycina is required for efficient export of the glycopeptide antibiotic balhimycin. (Appl Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [StaU]
MVMMPSIGGALRAGGGADPEPSRISPGTSRRVIAYLRPHSGKIAVFVVVAVLESLIVVAT
PLLLKQIVDEGILKHDSKTVTLLACLTAGLAVLDALLQLALAYIAGAIGQGVSYDLRIRA
IGHVQRLPVAFFTRTQTGVLVGRLHTDLIMTQQAFSQLLMAVTGAVSVVLVMAELFYLSW
LVALITLVLIPLFLIPWVYVGRVIQRHTRQSMEVNAGLAGLLQERFNVQGAMLSKLFGRP
HEEMAEYEDRSRKLRRIGVNVVVFSRMAFIIMALMASLATALTYGVGGGLVLSGTFQLGT
LVALATLLGRLFGPITQLSGMQANAVIVLVSFDRIFELLDLKPLIEERSDAVVLRSDTAP
EIEFEDVSFRYPGADEVSLPSLEQNVRGGREPGEATPEVLRHVSLHAPAGTLTALVGPSG
AGKSTLTHLVSRLYDPTSGTVRVGGLDLRDLSFASLHETVGVVSQDTYLFHDTIRENLRY
ARPSAMEDEVIEACKGAQIWDLIESLPRGLDTVVGDRGYRLSGGEKQRLAIARLLLKAPS
VVVLDEATAHLDSESEAAVQRALRTALRDRTSLVIAHRLSTIREADQIVVIDDGGVRERG
THEELLAEGGLYAELYHTQFANSGGDGAAPEGDGAGPVPQMAAEGGR
selected fasta
>putative ABC transporter ATP-binding/permease protein [StaU]
ATGGTCATGATGCCGTCCATCGGGGGGGCGCTGAGGGCCGGCGGAGGTGCTGATCCCGAG
CCGTCCAGGATCAGCCCCGGCACGTCCCGCAGAGTGATCGCCTACCTTCGCCCGCACAGC
GGAAAGATCGCGGTCTTCGTCGTCGTCGCCGTCCTGGAGTCGCTCATCGTGGTGGCGACT
CCGCTGTTGCTCAAGCAGATCGTCGACGAGGGGATCCTCAAGCACGACTCCAAAACCGTC
ACCCTGCTGGCCTGCCTCACCGCCGGGCTCGCCGTCCTCGACGCGTTACTGCAGCTGGCG
CTCGCCTACATCGCCGGTGCGATCGGGCAGGGGGTCAGCTACGACCTCCGGATCCGGGCG
ATCGGTCACGTCCAGCGGCTGCCGGTCGCGTTCTTCACCCGCACCCAGACCGGGGTCCTG
GTCGGACGGCTCCACACGGACCTGATCATGACGCAGCAGGCCTTCAGCCAGCTGCTGATG
GCGGTCACCGGCGCGGTCTCGGTCGTCCTGGTGATGGCCGAGCTGTTCTACCTGTCGTGG
CTCGTCGCCCTCATCACGCTGGTGCTGATCCCGCTGTTCCTCATTCCCTGGGTGTACGTG
GGCCGAGTGATACAGCGGCACACCAGGCAGTCGATGGAGGTGAACGCCGGCCTGGCCGGC
CTGCTGCAGGAGCGGTTCAACGTGCAGGGGGCGATGCTCTCCAAGCTCTTCGGCCGTCCG
CACGAGGAGATGGCCGAGTACGAGGACCGGTCGCGCAAGCTCCGCCGGATCGGGGTGAAC
GTCGTCGTCTTCAGCCGGATGGCCTTCATCATCATGGCGCTGATGGCCTCGCTCGCCACG
GCGCTCACCTACGGGGTCGGCGGCGGCCTCGTGCTCTCCGGGACCTTCCAGCTCGGCACG
CTGGTCGCTCTCGCCACCCTGCTGGGGCGGCTGTTCGGGCCGATCACCCAGCTCTCCGGG
ATGCAGGCGAACGCGGTGATCGTCCTGGTGAGCTTCGACCGGATCTTCGAGCTCCTCGAC
CTGAAGCCGCTGATCGAGGAACGCTCCGACGCCGTCGTGCTCAGGAGCGACACAGCCCCG
GAGATCGAGTTCGAGGACGTGTCGTTCCGCTATCCGGGTGCGGACGAGGTCTCGCTGCCG
TCGCTGGAGCAGAACGTGCGTGGCGGACGGGAGCCGGGGGAGGCGACGCCGGAGGTCCTG
CGCCACGTGAGCCTGCATGCGCCGGCCGGAACCCTCACCGCACTCGTCGGCCCGTCCGGC
GCGGGGAAGAGCACTCTCACCCACCTGGTGTCCCGGCTGTACGACCCGACCTCCGGCACC
GTCCGTGTCGGCGGACTCGATCTGCGGGATCTCTCCTTCGCCTCGCTGCACGAGACGGTG
GGCGTGGTCAGCCAGGACACCTACCTCTTCCACGACACCATTCGGGAGAACCTTCGCTAC
GCCCGTCCGAGCGCCATGGAGGACGAGGTGATCGAGGCGTGCAAGGGGGCCCAGATCTGG
GACCTGATCGAATCCCTCCCGAGAGGGCTCGACACCGTCGTGGGAGACCGCGGCTACCGG
CTGTCGGGCGGGGAGAAGCAGCGACTGGCCATCGCGAGGCTGCTGCTGAAGGCGCCCTCG
GTCGTCGTGCTCGACGAGGCCACCGCTCACCTGGACTCCGAGTCGGAGGCCGCCGTCCAG
CGGGCCCTCAGGACCGCGCTGCGCGACCGCACCTCTCTGGTGATCGCCCACCGGTTGTCC
ACGATCCGCGAGGCCGATCAGATCGTCGTGATCGACGACGGAGGCGTCCGTGAGCGCGGG
ACGCACGAGGAGCTGCTGGCCGAGGGCGGCCTCTACGCGGAGCTGTACCACACGCAGTTC
GCCAATTCGGGTGGCGACGGAGCCGCGCCCGAAGGCGACGGGGCCGGGCCGGTCCCCCAG
ATGGCTGCTGAAGGGGGACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [46-314]  1.4e-24 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [362-618]  PS50893
PS50893   ABC_TRANSPORTER_2
 [424-549]  1.3e-23 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [409-595]  3.39999972437717e-17 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [18-343]  4.60000044330866e-65 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [521-535]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [44-321]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [43-64]  Transmembrane (i-o) [79-101]  Transmembrane (o-i) [154-173]  Transmembrane (i-o) [178-200]  Transmembrane (o-i) [262-284]  Transmembrane (i-o)
Transmembrane 5