close all open/close all

CDS information : A4793_00150


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction43,657 / 44,352 / + [in whole cluster]
43,657 / 44,352 / + [in contig]
Location43657..44352 [in whole cluster]
43657..44352 [in contig]
TypeCDS
Length696 bp (231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)VanRst
GenevanRst
ORF19
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • two-domain response regulator
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q8CJW1
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[16420361] The vancomycin resistance VanRS two-component signal transduction system of Streptomyces coelicolor. (Mol Microbiol. , 2006)
ACC
Q799B5
NITE
Balhi_00020
PmId
[21690280] Self-resistance and cell wall composition in the glycopeptide producer Amycolatopsis balhimycina. (Antimicrob Agents Chemother. , 2011)

close this sectionSequence

selected fasta
>putative two-component system response regulator [VanRst]
MRVLIVEDELYMAEAIRDGLRLEAIAADIAGDGDTALELLSVNAYDIAVLDRDIPGPSGD
EVAERIVATGSGMPILMLTAADRLDDKASGFQLGADDYLTKPFELRELILRIRALDRRRA
HIRPPVREIAGLRLDPFRREVYRDDRYIALTRKQFAVLEVLVAAEGGVVSAEELLERAWD
ENADSFTNAVRITVSALRKRLGEPQIIATVPGVGYRIATPTDIRREGDAGA
selected fasta
>putative two-component system response regulator [VanRst]
ATGCGTGTCTTGATCGTCGAGGACGAGCTGTACATGGCAGAGGCCATCCGCGACGGGCTG
CGCCTGGAGGCGATCGCGGCGGACATCGCCGGAGACGGCGACACCGCGTTGGAGCTACTG
AGCGTCAACGCCTACGACATCGCCGTTCTCGACCGCGACATTCCCGGCCCTTCCGGTGAC
GAGGTCGCCGAGCGGATCGTCGCGACGGGATCCGGAATGCCCATCCTCATGCTCACCGCC
GCCGACCGGCTCGACGACAAGGCCTCCGGGTTTCAGCTCGGTGCCGACGACTACCTCACC
AAGCCGTTCGAACTGCGTGAACTGATCCTCCGGATCAGGGCGCTCGACCGCAGGCGCGCG
CACATAAGGCCGCCCGTGCGGGAGATCGCGGGCCTGCGCCTGGACCCCTTCCGTCGCGAG
GTCTACCGCGACGACCGCTACATCGCACTCACCCGCAAACAATTCGCCGTGCTCGAAGTG
CTCGTCGCCGCCGAGGGCGGCGTCGTCAGCGCCGAGGAACTGTTGGAGCGGGCCTGGGAC
GAGAACGCCGACTCGTTCACCAACGCCGTGCGTATCACGGTCTCGGCTCTGCGCAAACGC
CTCGGTGAACCTCAGATCATCGCCACCGTGCCCGGCGTCGGATACCGGATTGCCACCCCG
ACGGACATCAGGCGTGAGGGCGATGCGGGTGCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [3-112]  5.69999999999998e-21 PF00072
PF00072   Response_reg
 [1-112]  4.40000933643891e-32 SM00448
SM00448   REC
 [2-116]  PS50110
PS50110   RESPONSE_REGULATORY
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [145-217]  1.20000117458134e-22 SM00862
SM00862   Trans_reg_C
 [147-217]  6.40000000000001e-19 PF00486
PF00486   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-187]  1.40000506907309e-34 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [126-219]  1.4e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit