close all open/close all

CDS information : A4793_00160


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction44,345 / 45,442 / + [in whole cluster]
44,345 / 45,442 / + [in contig]
Location44345..45442 [in whole cluster]
44345..45442 [in contig]
TypeCDS
Length1,098 bp (365 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)VanSst
GenevanSst
ORF18
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • Transmembrane histidine kinase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q9X942
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[16420361] The vancomycin resistance VanRS two-component signal transduction system of Streptomyces coelicolor. (Mol Microbiol. , 2006)
[20383152] A vancomycin photoprobe identifies the histidine kinase VanSsc as a vancomycin receptor. (Nat Chem Biol. , 2010)
[23836175] In vivo studies suggest that induction of VanS-dependent vancomycin resistance requires binding of the drug to D-Ala-D-Ala termini in the peptidoglycan cell wall. (Antimicrob Agents Chemother. , 2013)

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [VanSst]
MHRAPGMSVRLKFTLSYAGFVMLAGTLMLVTVWVYLLRGLPDAASSPNGLVPVRAIVLHA
YAPATAVVLALLLVFGLLGGWLLAGRMLAPLTRITDATRTAANGSLSHRIELEGRKDEFR
ELADAFDTMLARLEAHVAEQRRFAATASHELRTPLAITKALLEVTINGPGRDLGELIGRL
HNVNARAIDLTEALLLLSRADQRSFTREPVDLSLNVEEAVETLLPLAEKHGVAIEASGDI
TPAMGSRALLLQLTVNLIHNAIVHNLHGRGIVRVTTGIESGSVTLSVENTGEVLPAQLVS
TLTEPFRRGTERIRQDHAGVGLGLAIVKSITEAHDGTLTIVPRPGGGLQVTVRLPAAPPP
ETLNR
selected fasta
>putative two-component system histidine kinase [VanSst]
GTGCATAGGGCACCGGGCATGAGCGTCCGCCTCAAATTCACCCTCAGCTATGCGGGCTTC
GTCATGCTCGCGGGCACGCTGATGCTGGTCACCGTGTGGGTGTACCTGTTGCGCGGCCTG
CCCGATGCGGCGAGCAGCCCCAACGGGCTCGTACCCGTCCGCGCCATCGTGCTGCACGCC
TACGCTCCGGCGACGGCCGTAGTGCTGGCCCTCCTGCTGGTGTTCGGCCTGCTGGGAGGG
TGGCTGCTCGCCGGCCGGATGCTCGCCCCACTGACCCGCATCACCGACGCCACCCGCACG
GCCGCGAACGGCTCGCTCTCCCACCGGATCGAGCTGGAAGGCCGCAAGGACGAGTTCCGC
GAGCTGGCCGACGCCTTCGACACCATGCTCGCGCGCCTTGAGGCGCACGTCGCCGAGCAG
CGGAGGTTCGCGGCCACCGCCTCCCACGAGCTGCGCACCCCGCTGGCGATCACGAAGGCC
CTTCTCGAAGTGACGATCAACGGCCCGGGGCGAGACCTGGGCGAGCTGATCGGACGCCTC
CACAACGTCAATGCCAGGGCGATCGACCTCACCGAGGCGTTGCTCCTGCTCAGCCGCGCC
GACCAGCGCTCCTTCACCCGGGAGCCCGTCGACCTGTCACTGAACGTCGAGGAGGCCGTC
GAGACACTGCTTCCCCTGGCGGAGAAGCACGGCGTCGCCATCGAGGCCTCCGGCGACATC
ACCCCGGCCATGGGCTCCCGCGCGCTCCTGCTGCAGCTGACGGTCAATCTCATCCATAAC
GCGATCGTCCACAACCTGCACGGTCGGGGCATCGTGCGAGTGACGACCGGCATCGAGTCC
GGAAGCGTGACGCTCAGCGTCGAGAACACCGGCGAGGTTCTCCCGGCTCAGCTGGTCTCG
ACCCTCACCGAGCCCTTCCGGCGGGGCACCGAACGCATCCGCCAGGACCACGCGGGCGTC
GGCCTGGGTCTGGCCATCGTCAAGAGCATCACCGAAGCACACGACGGAACGCTCACCATC
GTCCCGCGACCCGGAGGCGGCCTCCAGGTCACGGTGCGGCTGCCGGCCGCGCCTCCGCCG
GAAACCCTCAACAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [245-358]  1.5e-21 SM00387
SM00387   Histidine kinase-like ATPases
 [204-359]  2.1e-34 SSF55874
SSF55874   ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
 [205-361]  2e-29 G3DSA:3.30.565.10
G3DSA:3.30.565.10   no description
 [250-356]  3.6e-18 PF02518
PF02518   HATPase_c
IPR003660 HAMP linker domain (Domain)
 [85-138]  11.073 PS50885
PS50885   HAMP
 [85-138]  1.8e-12 SM00304
SM00304   HAMP (Histidine kinases, Adenylyl cyclases,
 [66-134]  8.8e-18 PF00672
PF00672   HAMP
IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (Domain)
 [139-203]  4.7e-07 SM00388
SM00388   His Kinase A (phosphoacceptor) domain
 [140-202]  3.9e-08 PF00512
PF00512   HisKA
IPR004358 Signal transduction histidine kinase-related protein, C-terminal (Domain)
 [283-297]  5.4e-09 PR00344 [318-336]  5.4e-09 PR00344 [342-355]  5.4e-09 PR00344
PR00344   BCTRLSENSOR
IPR005467 Signal transduction histidine kinase, core (Domain)
 [146-358]  33.832 PS50109
PS50109   HIS_KIN
IPR009082 Signal transduction histidine kinase, homodimeric (Domain)
 [121-205]  3e-14 SSF47384
SSF47384   Homodimeric domain of signal transducing histidine kinase
SignalP No significant hit
TMHMM
 [13-35]  Transmembrane (i-o) [61-83]  Transmembrane (o-i)
Transmembrane 2