close all open/close all

CDS information : A4793_00170


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction45,985 / 45,521 / - [in whole cluster]
45,985 / 45,521 / - [in contig]
Locationcomplement(45521..45985) [in whole cluster]
complement(45521..45985) [in contig]
TypeCDS
Length465 bp (154 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative Rrf2 family transcriptional regulator
Product (GenBank)StaS
GenestaS
ORF17
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • putative DNA binding protein
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O34527
PmId
[16513748] Global control of cysteine metabolism by CymR in Bacillus subtilis. (J Bacteriol. , 2006)
[18974048] The CymR regulator in complex with the enzyme CysK controls cysteine metabolism in Bacillus subtilis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR000944

close this sectionSequence

selected fasta
>putative Rrf2 family transcriptional regulator [StaS]
MRITARTDYAVRAMAELAAEGETPLTAEELSARQDIPVRFLFGILRELRLARLVHSVRGP
QGGYLLASAAEEITLAAVIRAVDGPLASVRELSLTGLEYPGPAAVLPDVWRAVRTSLRQV
LETTTLADLARGELPEIVRSRAEEYRTGVRDHEQ
selected fasta
>putative Rrf2 family transcriptional regulator [StaS]
ATGCGGATCACGGCACGGACGGACTACGCGGTGCGGGCGATGGCGGAGCTGGCAGCCGAG
GGTGAGACCCCCTTGACCGCCGAGGAGCTGTCCGCCCGCCAGGACATCCCGGTGCGGTTC
CTCTTCGGCATCCTGAGGGAGCTGCGCCTGGCCCGTCTGGTGCACAGCGTGCGTGGTCCC
CAGGGCGGATACCTGCTGGCCTCCGCCGCGGAGGAGATCACTCTGGCGGCCGTGATCCGC
GCGGTGGACGGCCCGCTGGCCAGCGTGCGGGAGCTCAGCCTGACGGGCCTCGAGTACCCG
GGGCCGGCCGCCGTTCTCCCCGACGTGTGGCGGGCGGTGCGTACCAGTCTGCGCCAGGTG
CTGGAGACCACCACGCTTGCCGACCTCGCCCGTGGCGAGCTGCCGGAGATCGTGCGGTCC
CGGGCCGAGGAGTACCGCACCGGCGTTCGCGATCACGAGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000944 Transcription regulator Rrf2-like (Family)
 [2-131]  PS51197
PS51197   HTH_RRF2_2
 [1-82]  7.79999999999999e-26 PF02082
PF02082   Rrf2
 [48-66]  PS01332
PS01332   HTH_RRF2_1
 [1-130]  1.09999999999999e-35 TIGR00738
TIGR00738   Rrf2_super
SignalP No significant hit
TMHMM No significant hit