close all open/close all

CDS information : A4793_00180


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction46,330 / 49,038 / + [in whole cluster]
46,330 / 49,038 / + [in contig]
Location46330..49038 [in whole cluster]
46330..49038 [in contig]
TypeCDS
Length2,709 bp (902 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)StaR
GenestaR
ORF16
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • putative flavoprotein
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [StaR]
MTSTTAQGPVAIVGAGAAGALVALQLCETAVRRHTPLELLLIDPAPEAGRGTAYATRDPR
HLLNVPAGDMSCYPDDPGHFVRWLCRHGEPTVTAADFASRYRYGAYLADTLGRAVIAAQG
TVRVRRLRSRVVDCHWSGGLARLQLADGTAVDAAGVVLATGPTPSSPASLPSALRAGDRF
IADPWAPGALDAPADEGRRDDVLLIGTGLTAVDVALRLGRFGRTVYAVSRNGRLPEAHAV
SPLPAAACTEPLRDLPLPELRATIHRHIGRVMRAQGDWRPALDGLRPHTAEVWASLTAEE
RAEFLRRDGSLWNTHRHRMPPATAESVHRMRRTRRLRTGRGRITDVRTLPDGALSVSFTD
GRELRVGWVVDCTGPGLLLADTPDPLWRTLLRRGEAVPGPLGIGVSTAGGRLRGRDGRTS
RAMWTLGSPRRGELWETTAIPEIRAQAVAVAEAVLAERAPLASGAAPARQGVRRPTDGGG
LPLSTHHAAAAAYRSGVDRLLKVRAGAQEALRRAVALDPGFTAGHAALALIGHECGADVD
VPRALAEARRCARERADERERSFVEVVSRRVEGSPAEGDAALLRHLDSHPGDRLALAAAV
PTIAFSGLYDLDGSAALRVVERTAPAHEGHWFHTSLLAFVRQEQGRYDEAGTLAEQALGE
EPASGHAMHALAHVHYEQGDHPQGRDRLDAWLGGHGRGGTHRAHFAWHAALHELASDDAE
AVRRRWATHLSPGKVAGIRALVDSGSLLWRARMAGHWQGRVPVDDVLESVAADVLERPAT
AFTALHAAVTLTAAGDLPGLRRLQAHALGADSVQRAVIAPLCEAFAHVVEENWAEAAQRL
ERVLPALRAVGGSAAQREVVEETLVYALISAGRCDAARTRLAERLDRRFSPYDRRRLATL
PS
selected fasta
>hypothetical protein [StaR]
ATGACGTCAACGACAGCGCAGGGTCCCGTCGCCATCGTGGGTGCGGGCGCGGCCGGCGCC
CTGGTCGCCCTCCAGCTCTGCGAGACGGCGGTCCGTCGGCATACGCCCCTGGAACTGCTG
TTGATCGACCCGGCGCCCGAGGCCGGCCGCGGCACCGCCTACGCCACCCGTGACCCGCGG
CACCTCCTCAACGTTCCGGCGGGCGACATGAGCTGTTACCCCGACGACCCGGGGCACTTC
GTCCGCTGGCTCTGTCGCCACGGCGAACCCACCGTCACCGCCGCCGACTTCGCCTCCCGC
TACCGTTACGGCGCCTACCTGGCGGACACCCTCGGCCGGGCCGTCATCGCCGCACAGGGC
ACCGTCCGCGTCCGCCGGCTGCGCAGCCGGGTGGTGGACTGCCACTGGAGCGGCGGACTC
GCCCGGCTCCAGCTGGCCGACGGCACGGCCGTGGACGCCGCCGGCGTGGTGCTGGCCACC
GGCCCCACTCCCTCGTCCCCGGCGTCACTGCCGTCCGCGCTGCGCGCGGGCGACCGGTTC
ATCGCCGACCCGTGGGCGCCGGGCGCCCTGGACGCCCCGGCCGACGAGGGCCGCCGGGAC
GACGTCCTGCTGATCGGCACCGGGCTGACCGCGGTGGACGTGGCCTTACGGCTGGGCCGC
TTCGGCCGCACGGTGTACGCCGTGTCCCGCAACGGCCGGCTGCCCGAGGCACACGCGGTG
AGCCCCCTGCCCGCCGCGGCCTGCACCGAACCCCTCAGGGACCTGCCGCTGCCGGAACTG
CGCGCCACGATCCACCGGCACATCGGAAGGGTCATGCGGGCCCAGGGCGACTGGCGCCCC
GCGCTGGACGGGCTGCGCCCGCACACCGCCGAGGTGTGGGCGTCGCTCACCGCCGAGGAG
CGCGCCGAGTTCCTGCGGCGGGACGGCTCGCTGTGGAACACGCACCGGCACCGGATGCCC
CCGGCCACCGCGGAGAGTGTGCATCGTATGCGCCGTACCCGGCGGCTGCGTACCGGGCGG
GGGCGGATCACCGATGTCAGAACGCTCCCGGACGGCGCGCTCTCGGTCTCCTTCACCGAC
GGCCGGGAGTTGCGGGTGGGCTGGGTGGTGGACTGCACCGGCCCCGGTCTGCTGCTGGCG
GACACGCCCGATCCGCTGTGGCGCACCCTGTTGCGGCGCGGCGAGGCGGTGCCCGGCCCG
CTGGGCATCGGCGTGTCCACCGCCGGAGGACGCCTGCGCGGCCGGGACGGGCGGACGAGC
CGCGCCATGTGGACGCTGGGTTCGCCGCGCCGCGGCGAACTGTGGGAGACGACCGCGATT
CCGGAGATCCGCGCGCAGGCGGTGGCCGTGGCCGAGGCGGTGCTCGCCGAGCGGGCGCCT
CTGGCCTCCGGCGCCGCACCCGCCCGGCAAGGAGTGCGGCGGCCCACCGACGGCGGCGGG
CTTCCGCTCAGTACGCACCACGCCGCTGCCGCCGCCTACCGCTCGGGAGTGGACCGTCTG
CTGAAGGTGCGGGCCGGGGCCCAGGAGGCGTTACGCCGAGCCGTCGCGCTCGACCCGGGC
TTCACCGCCGGCCACGCGGCGCTCGCGCTGATCGGGCACGAGTGCGGGGCCGACGTGGAC
GTGCCGCGGGCCCTGGCCGAGGCCCGGCGCTGCGCGCGTGAGCGGGCCGACGAACGCGAG
CGTTCTTTCGTGGAGGTGGTCTCCCGGCGGGTCGAGGGCAGCCCCGCGGAGGGCGACGCC
GCGCTCCTGCGCCACCTGGACAGCCATCCCGGCGACCGGCTCGCGCTCGCGGCCGCCGTC
CCCACCATCGCCTTCTCCGGCCTGTACGACCTCGACGGCAGCGCCGCGCTGCGGGTGGTC
GAGCGGACCGCACCCGCACACGAGGGGCACTGGTTCCACACCTCGCTGCTGGCGTTCGTA
CGCCAGGAGCAGGGCCGTTACGACGAGGCCGGCACCCTCGCCGAGCAGGCCCTCGGCGAG
GAACCCGCCTCCGGACACGCCATGCACGCCCTGGCGCACGTGCACTACGAGCAGGGCGAC
CATCCCCAGGGCCGGGACCGGCTCGACGCATGGCTGGGCGGCCACGGCCGCGGCGGCACG
CACCGCGCCCACTTCGCCTGGCACGCCGCCCTGCACGAGCTGGCATCCGACGACGCGGAA
GCCGTTCGCCGCAGGTGGGCCACCCATCTGTCGCCCGGGAAGGTGGCCGGCATCCGGGCG
CTGGTCGACTCCGGTTCGCTGCTGTGGCGGGCCCGGATGGCCGGCCACTGGCAGGGCCGG
GTCCCCGTCGACGACGTACTGGAGTCGGTCGCGGCGGACGTCCTGGAGCGCCCGGCCACC
GCCTTCACCGCCCTGCACGCCGCGGTCACCCTCACCGCCGCGGGGGACCTGCCCGGGCTG
CGCCGCCTGCAGGCCCACGCGCTGGGTGCCGACTCGGTGCAGCGGGCGGTGATCGCCCCG
CTGTGCGAGGCGTTCGCACACGTGGTGGAGGAGAACTGGGCCGAGGCGGCACAACGGCTG
GAACGCGTCCTGCCGGCACTGCGCGCGGTGGGCGGCAGCGCTGCGCAGCGCGAGGTCGTC
GAGGAGACGCTGGTGTACGCGCTGATCTCGGCGGGTCGCTGTGACGCGGCCAGGACGCGT
CTGGCGGAACGCCTGGACCGCCGCTTCTCCCCCTACGACCGACGCCGCCTGGCGACGCTC
CCCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011990 Tetratricopeptide-like helical (Domain)
 [266-279]  5.20000000000001e-11 G3DSA:1.25.40.10 [506-596]  5.20000000000001e-11 G3DSA:1.25.40.10 [635-688]  5.20000000000001e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR013027 FAD-dependent pyridine nucleotide-disulphide oxidoreductase (Family)
 [10-29]  1.40000045763982e-06 PR00368 [153-171]  1.40000045763982e-06 PR00368 [201-219]  1.40000045763982e-06 PR00368
PR00368   FADPNR
IPR016040 NAD(P)-binding domain (Domain)
 [10-65]  2.7e-11 G3DSA:3.40.50.720 [106-211]  2.7e-11 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit