close all open/close all

CDS information : A4793_00190


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction50,222 / 49,419 / - [in whole cluster]
50,222 / 49,419 / - [in contig]
Locationcomplement(49419..50222) [in whole cluster]
complement(49419..50222) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)DpgD
GenedpgD
ORF15
Gene (GenBank)dpgD
EC number4.2.1.-
Keyword
  • Dpg
Note
Note (GenBank)
  • enhances DpgA activity
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52797
NITE
Chlor_00310
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [DpgD]
MTGDRTRVRYEKKQHVARITLDRPDVLNAMDLRMHEELAEIWDDVEADDDIRVAVLTGAG
DRAFSVGQDLKERARLDRQGVAPTTFGSRGQPGWPRLTDRFTLYKPVLARVHGYALGGGF
ELALACDLIIASDQAVFALPEARLGLVPGAGGAFRLARQLPEKIAMGYLLTGRRLSAATA
LRHGLVNEVVPADRLDACVQEWTDDLVRSAPLSVRAIKEAAAKSVDMPLEQAFTAEYGWE
ERRRRSSDAVEGVRAFADRRDPVWTGR
selected fasta
>putative enoyl-CoA hydratase [DpgD]
ATGACCGGCGACCGTACGCGGGTGCGCTACGAGAAGAAGCAGCACGTCGCCCGTATCACG
CTCGACCGTCCCGACGTGCTCAACGCGATGGATCTGCGCATGCACGAGGAGCTCGCCGAG
ATCTGGGACGACGTCGAGGCCGACGACGACATCAGGGTCGCCGTGCTGACCGGAGCGGGT
GACCGTGCCTTCTCCGTCGGCCAGGACCTCAAGGAGCGGGCCCGCCTGGACCGTCAGGGC
GTCGCTCCGACGACCTTCGGCAGCCGCGGGCAGCCGGGCTGGCCCCGGCTCACCGACCGC
TTCACGCTGTACAAACCGGTGCTCGCACGGGTCCACGGTTACGCCCTGGGCGGCGGTTTC
GAACTCGCCCTGGCCTGCGACCTGATCATCGCCTCGGACCAGGCGGTCTTCGCCCTGCCC
GAGGCGCGGCTCGGTCTCGTGCCCGGTGCGGGCGGTGCGTTCCGGCTGGCCAGGCAGCTG
CCGGAGAAGATCGCCATGGGGTACCTGCTCACCGGTCGTCGGCTGAGCGCCGCGACGGCC
CTGCGCCACGGGCTCGTCAACGAGGTGGTCCCGGCCGACCGGTTGGACGCCTGCGTCCAG
GAGTGGACCGACGACCTGGTCCGCAGCGCCCCGCTCTCGGTCCGGGCCATCAAGGAAGCC
GCTGCGAAATCCGTCGACATGCCCCTCGAGCAGGCGTTCACCGCCGAGTACGGCTGGGAG
GAGCGCCGCAGGCGCAGCAGCGACGCGGTCGAAGGAGTCCGGGCCTTCGCGGACAGGCGC
GATCCCGTCTGGACCGGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [10-257]  5.89999999999994e-61 PF00378
PF00378   ECH
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site (Conserved_site)
 [108-128]  PS00166
PS00166   ENOYL_COA_HYDRATASE
SignalP No significant hit
TMHMM No significant hit