close all open/close all

CDS information : A4793_00210


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction52,209 / 51,532 / - [in whole cluster]
52,209 / 51,532 / - [in contig]
Locationcomplement(51532..52209) [in whole cluster]
complement(51532..52209) [in contig]
TypeCDS
Length678 bp (225 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative enoyl-CoA hydratase
Product (GenBank)DpgB
GenedpgB
ORF13
Gene (GenBank)
EC number
Keyword
  • Dpg
Note
Note (GenBank)
  • enhances DpgA activity
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52796
NITE
Chlor_00290
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>putative enoyl-CoA hydratase [DpgB]
MEDALTLTIDGTEPLSAASVKAVAAVCDRAEDLARDDRGAGVVTVHVSGAPEGAWTSGLD
VMLVTKWERVLRRLERLPMATVAVASGDCGGPALDVLLTTDIRVATPDTRMSVPRDGSAT
WPGMAAYRLVQQAGVGRIRRAVLFGLPIGAADAVRLGIVDELADDPAAAVAAAAELVAGL
AGKEVAIRRQLLFDATTTSFEDVLGPHLAACDRALRGKDVAEESV
selected fasta
>putative enoyl-CoA hydratase [DpgB]
GTGGAGGACGCGCTGACCCTCACGATCGACGGGACGGAGCCGCTGTCGGCCGCCTCCGTC
AAGGCAGTCGCGGCCGTCTGTGACCGGGCCGAGGACCTCGCCCGCGACGACCGCGGCGCC
GGCGTGGTGACCGTGCACGTCTCCGGAGCCCCCGAAGGGGCCTGGACCAGCGGGCTGGAC
GTCATGCTGGTCACCAAGTGGGAACGGGTTCTGCGTCGGCTGGAACGGCTCCCCATGGCC
ACCGTCGCGGTGGCCTCGGGTGACTGCGGCGGGCCGGCCCTGGACGTCCTCCTGACCACC
GACATCCGCGTGGCCACCCCCGACACGCGGATGTCGGTCCCCCGCGACGGCTCCGCCACC
TGGCCCGGGATGGCCGCATACCGGCTCGTCCAGCAGGCCGGCGTCGGCAGGATCCGCCGG
GCGGTGCTGTTCGGCCTGCCCATCGGCGCCGCCGACGCGGTGCGGCTGGGGATCGTCGAC
GAACTGGCCGACGATCCGGCGGCTGCGGTGGCGGCAGCGGCGGAACTGGTCGCCGGTCTG
GCAGGCAAGGAGGTGGCGATCAGACGCCAGCTCCTGTTCGACGCCACGACGACGAGCTTC
GAGGACGTCCTCGGCCCCCACCTGGCCGCCTGCGACCGCGCCCTGCGCGGCAAGGACGTA
GCCGAGGAGTCTGTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001753 Crotonase, core (Domain)
 [66-188]  4.2e-13 PF00378
PF00378   ECH
SignalP No significant hit
TMHMM No significant hit