close all open/close all

CDS information : A4793_00220


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction53,393 / 52,221 / - [in whole cluster]
53,393 / 52,221 / - [in contig]
Locationcomplement(52221..53393) [in whole cluster]
complement(52221..53393) [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)DpgA
GenedpgA
ORF12
Gene (GenBank)
EC number
Keyword
  • type III PKS
  • Dpg
Note
Note (GenBank)
  • 3,5-Dihydroxyphenylacetyl-CoA synthetase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q939X3
NITE
Balhi_00320
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
ACC
O52795
NITE
Chlor_00280
PmId
[11752437] Glycopeptide antibiotic biosynthesis: enzymatic assembly of the dedicated amino acid monomer (S)-3,5-dihydroxyphenylglycine. (Proc Natl Acad Sci U S A. , 2001)
[12240210] Biosynthesis of the vancomycin group of antibiotics: characterisation of a type III polyketide synthase in the pathway to (S)-3,5-dihydroxyphenylglycine. (Chem Commun (Camb). , 2001)
[14744141] Role of the active site cysteine of DpgA, a bacterial type III polyketide synthase. (Biochemistry. , 2004)
[22492619] Chain elongation and cyclization in type III PKS DpgA. (Chembiochem. , 2012)

close this sectionPKS/NRPS Module

B1
CHS102..388

close this sectionSequence

selected fasta
>polyketide synthase [DpgA]
MGVDLQVTVNLDHPELLDAPVLETGVLSAEGRALPTPPRPRIVGVGTAVTRTSYSQQEVL
DAFGITDRKVRSIFLNSAIERRNLTLPPMDSDSVRVSESQGDLLDKHKKLAIEMGAEALH
ACLKRCGAELSDLRHLCCVTSTGFLTPGLSALLIRELGIDRHCSRSDIVGMGCNAGLNAL
NVVAGWSAAHPGELAVVLCAEACSAAYTMDSTMRTAVVNSLFGDGAAAVALLAGPGGATP
ATSEGPTVLKFASCIIPEAVDAMRYDWDRTQGRFSFFLDPQIPYVVGAHAETVVDRLLSG
TGLRRSDIGHWLVHSGGKKVIDAVVVNLGLTRHDVRHTIGVLRDQGNVSSGSFLFSYERL
LEEGITRPGEYGVLMTMGPGSTIETALVQW
selected fasta
>polyketide synthase [DpgA]
GTGGGGGTGGACCTTCAGGTGACCGTCAACCTCGATCATCCCGAATTACTCGACGCTCCT
GTCCTGGAGACCGGGGTCCTGTCCGCAGAGGGCCGCGCACTCCCCACTCCTCCACGGCCC
CGCATCGTCGGTGTGGGCACGGCCGTGACCCGCACGTCCTACTCACAGCAGGAAGTGCTG
GATGCCTTCGGGATCACCGATCGCAAGGTCCGCTCCATCTTCCTCAACAGCGCCATCGAG
CGACGCAACCTCACCCTGCCGCCCATGGACAGCGACTCCGTCCGGGTCTCGGAGTCCCAG
GGCGACCTGCTCGACAAGCACAAGAAGCTGGCGATCGAGATGGGCGCCGAGGCTCTGCAC
GCCTGTCTGAAGCGGTGCGGCGCCGAACTCTCGGATCTGCGTCACCTGTGCTGCGTGACG
TCCACCGGCTTCCTCACCCCCGGACTCAGCGCGCTGCTGATACGGGAACTGGGCATCGAC
CGCCACTGCAGCCGCAGCGACATCGTCGGCATGGGCTGCAACGCGGGACTCAACGCCCTC
AACGTGGTGGCGGGCTGGTCCGCCGCCCATCCCGGGGAACTCGCCGTGGTGCTGTGCGCG
GAGGCCTGCTCGGCCGCGTACACGATGGACTCGACGATGCGTACCGCAGTCGTCAACAGC
CTGTTCGGCGACGGAGCCGCGGCCGTCGCGCTGCTCGCGGGCCCCGGCGGCGCCACGCCG
GCCACCTCCGAGGGCCCGACCGTTCTGAAGTTCGCCAGCTGCATCATCCCCGAAGCGGTC
GACGCCATGCGCTACGACTGGGACCGCACCCAGGGCAGGTTCAGCTTCTTCCTCGACCCG
CAGATCCCGTACGTGGTGGGCGCGCACGCCGAGACCGTCGTCGACCGCCTGCTGTCCGGC
ACGGGCCTGCGCCGCAGCGACATCGGACATTGGCTGGTGCACTCCGGCGGCAAGAAGGTG
ATCGACGCCGTCGTCGTCAACCTGGGACTCACCCGGCATGACGTCCGGCACACCATCGGT
GTGCTGCGCGACCAGGGCAACGTTTCCAGCGGTTCGTTCCTTTTCTCGTACGAACGGCTC
CTCGAAGAGGGCATCACACGACCGGGAGAGTACGGAGTGCTCATGACCATGGGACCGGGC
TCGACGATCGAAACGGCGCTGGTCCAGTGGTGA
[1] CHS102..388
[1] CHS304..1164

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001099 Chalcone/stilbene synthase, N-terminal (Domain)
 [102-235]  5e-16 PF00195
PF00195   Chal_sti_synt_N
IPR011141 Polyketide synthase, type III (Family)
 [17-390]  1.59998835313644e-120 PIRSF000451
PIRSF000451   PKS_III
IPR012328 Chalcone/stilbene synthase, C-terminal (Domain)
 [272-388]  4.80000000000001e-14 PF02797
PF02797   Chal_sti_synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [37-236]  9e-46 G3DSA:3.40.47.10 [248-390]  4.30000000000003e-34 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [68-390]  1.99999636034521e-45 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit