close all open/close all

CDS information : A4793_00230


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction54,897 / 53,539 / - [in whole cluster]
54,897 / 53,539 / - [in contig]
Locationcomplement(53539..54897) [in whole cluster]
complement(53539..54897) [in contig]
TypeCDS
Length1,359 bp (452 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative aminotransferase
Product (GenBank)HpgT
GenehpgT
ORF11
Gene (GenBank)
EC number2.6.1.-
Keyword
  • Hpg
  • Dpg
Note
Note (GenBank)
  • p-Hydroxy- and 3,5-dihydroxyphenylglycineaminotransferase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q939Y4
NITE
Balhi_00210
PmId
[11495926] A polyketide synthase in glycopeptide biosynthesis: the biosynthesis of the non-proteinogenic amino acid (S)-3,5-dihydroxyphenylglycine. (J Biol Chem. , 2001)
ACC
O52815
NITE
Chlor_00180
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>putative aminotransferase [HpgT]
MLSGFLTPQANSPAALTATEPVTLRKTDLHGSVSDPVLDTMNFLNEVTLRYPDAISFAPG
RPYDGFFDNEQIFSHIRRYLEHLQEQGSSPQQIRTAMYQYGPTAGQIREIIADSLRADED
IDAPAESVVVTVGAQEAMLLVLRALISGPDDVLLVSSPCYVGITGAARLLDIALTPVVER
EDGFSCADLEAAIQHEKARGRRPRAFYLVPDHANPSGNTLGLRARAELLELAARHGILIL
EDSPYRMVSPGRPLPTLKSLDRARTVVHLGSYSKTIFPGARVGFVVADQVVVDQDGRSSL
LADELVKIKSMVTVNTSSLSQAAVAGALLAAQGRVSELNARAGAYYGDAMQCTLRHLDAR
LPADRRASLGVRWNEPTGGFFLTVQVPFRADEAALTRSAQDFGVIWTPMEHFHPEKGGHH
AMRLSISYLTPTEIDEGTARLARFIEAESAKA
selected fasta
>putative aminotransferase [HpgT]
ATGCTGTCGGGTTTCCTCACGCCACAGGCGAATTCCCCCGCGGCCCTCACCGCGACCGAA
CCGGTGACCTTACGGAAGACGGACCTGCACGGCAGCGTCTCCGATCCGGTCCTGGACACG
ATGAACTTCCTCAACGAGGTTACGCTTCGCTATCCCGACGCGATCTCCTTCGCTCCCGGC
CGTCCTTATGACGGGTTCTTCGACAACGAGCAGATCTTCTCCCACATCCGCCGGTACCTG
GAGCACCTCCAGGAACAGGGGAGTTCACCGCAGCAGATCCGCACCGCCATGTACCAGTAC
GGGCCGACGGCCGGTCAGATCCGCGAGATCATCGCCGACTCGCTGCGCGCCGACGAGGAC
ATCGACGCCCCCGCCGAGTCCGTCGTGGTGACCGTCGGCGCCCAGGAGGCCATGCTGCTG
GTGCTGCGTGCCCTGATCAGCGGCCCCGACGACGTCCTGCTCGTCTCCAGTCCCTGCTAT
GTGGGGATCACCGGCGCGGCCCGCCTGCTGGACATCGCACTGACTCCGGTCGTGGAACGG
GAGGACGGGTTCTCCTGTGCCGACCTGGAGGCGGCCATCCAGCACGAGAAGGCCCGCGGG
CGCCGTCCCCGTGCCTTCTACCTGGTGCCCGACCACGCCAATCCGTCGGGGAACACACTG
GGGCTGCGGGCCCGCGCCGAACTCCTGGAACTCGCCGCGCGCCACGGCATCCTCATCCTG
GAGGACAGCCCCTACCGGATGGTCAGTCCCGGCCGCCCGCTGCCGACCCTGAAGTCCCTG
GACCGCGCCCGCACGGTCGTCCACCTGGGTTCCTACTCCAAGACGATCTTTCCCGGCGCC
CGGGTCGGCTTCGTCGTCGCCGACCAGGTCGTCGTGGACCAGGACGGCCGGAGCAGCCTC
CTCGCGGACGAACTCGTCAAGATCAAGAGCATGGTGACGGTGAACACCTCGTCGCTGAGC
CAGGCCGCCGTGGCGGGCGCGCTGCTTGCCGCCCAGGGCCGGGTCTCGGAGCTGAACGCC
AGAGCAGGCGCCTATTACGGCGACGCCATGCAGTGCACGCTCCGGCATCTGGACGCACGC
CTTCCGGCGGACCGGCGAGCATCTCTGGGGGTGCGCTGGAACGAACCGACCGGCGGATTC
TTCCTGACCGTGCAGGTCCCGTTCCGGGCGGACGAGGCCGCACTCACCCGGTCCGCACAG
GACTTCGGCGTGATCTGGACCCCGATGGAGCACTTCCACCCGGAAAAGGGCGGCCACCAC
GCCATGCGGCTCTCCATCAGCTATCTGACTCCCACCGAGATCGACGAGGGGACCGCTCGC
CTCGCCCGCTTCATCGAGGCGGAGAGCGCGAAGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004839 Aminotransferase, class I/classII (Domain)
 [99-440]  2.2e-21 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [93-317]  1.9e-44 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [318-446]  8.3e-08 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [17-446]  1.79999754022378e-71 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit