close all open/close all

CDS information : A4793_00240


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction56,213 / 55,059 / - [in whole cluster]
56,213 / 55,059 / - [in contig]
Locationcomplement(55059..56213) [in whole cluster]
complement(55059..56213) [in contig]
TypeCDS
Length1,155 bp (384 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative prephenate dehydrogenase
Product (GenBank)Pdh
Genepdh
ORF10
Gene (GenBank)
EC number1.3.1.-
Keyword
  • Hpg
Note
Note (GenBank)
  • Prephenate dehydrogenase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q04983
PmId
[7916685] An allosterically insensitive class of cyclohexadienyl dehydrogenase from Zymomonas mobilis. (Eur J Biochem. , 1993)
Family/Domain
FD
IPR003099

close this sectionSequence

selected fasta
>putative prephenate dehydrogenase [Pdh]
MMRAMAVIGTGLIGTSVALAASRQGVVVYLSDRNPSAARTAAALGAGLTQTPAERVDLAV
LAVPPSQVGTVLTEVQKRELAVSYTDVASVKAGPEQVALAQAPDPSRYIGGHPLAGREQS
GPLAARAELFRDRPWALTPSPMTSNATFNRALELVALCGAVPVVTQSQAHDDAVALTSHV
PHLLASLMAARLRDAPAEMSRLAGNGLRDVTRIAGGDSRLWGDILQSNAGAVVGVVKRVH
EDLTRLVAALDQLAERGGEDRDDGLRTMMELLDRGVAGLAEIPGRRVGGGGRAVRVTVRD
RPGELPRLLGVVADFGVVPEDATVDADEAGALTVDFTVPPGAADRMVAELRADGWEAVRP
NGIGPYFREMARKEDGIPSEAVSK
selected fasta
>putative prephenate dehydrogenase [Pdh]
ATGATGCGCGCCATGGCCGTCATCGGCACGGGTCTGATCGGTACCTCGGTCGCGCTCGCG
GCAAGTCGGCAGGGAGTGGTGGTGTATCTGTCCGACCGGAACCCGTCTGCGGCCAGGACG
GCCGCCGCACTCGGTGCGGGACTCACCCAGACTCCCGCGGAGCGGGTGGACCTGGCCGTG
CTCGCCGTACCGCCGAGCCAGGTCGGCACGGTGCTCACGGAGGTGCAGAAACGCGAGCTC
GCCGTCAGCTACACCGACGTGGCGAGCGTGAAGGCCGGGCCGGAACAGGTCGCGTTGGCC
CAGGCTCCGGATCCGTCCCGCTACATCGGGGGTCACCCGCTGGCGGGCCGGGAGCAGTCG
GGCCCGCTGGCGGCCCGTGCCGAACTGTTCCGGGACCGCCCGTGGGCGCTCACCCCGTCG
CCGATGACGTCCAACGCGACCTTCAACCGGGCCCTGGAACTGGTGGCGCTGTGCGGCGCG
GTGCCGGTGGTGACCCAGAGCCAGGCACACGACGACGCGGTTGCCCTCACCTCCCACGTA
CCGCATCTGCTGGCGAGCCTGATGGCGGCGCGGCTGCGGGACGCCCCGGCCGAGATGTCC
AGGCTCGCGGGTAACGGACTGCGCGACGTCACCCGGATCGCGGGCGGTGACTCACGCCTG
TGGGGCGACATCCTCCAGTCCAACGCGGGGGCCGTGGTGGGTGTCGTGAAGCGCGTGCAC
GAGGACCTGACCCGGCTGGTGGCCGCCCTGGACCAGCTCGCCGAGCGGGGCGGCGAGGAC
CGGGACGACGGCCTGCGGACGATGATGGAGCTGCTCGACCGGGGTGTCGCCGGGCTTGCC
GAGATCCCCGGGCGCCGCGTCGGCGGCGGTGGGAGGGCCGTACGTGTGACCGTCCGGGAC
CGTCCCGGGGAGCTGCCGCGGCTGCTGGGCGTCGTCGCGGACTTCGGCGTCGTCCCCGAG
GACGCCACCGTCGACGCCGACGAGGCCGGCGCGCTCACCGTGGACTTCACCGTCCCGCCG
GGGGCCGCCGACCGGATGGTGGCCGAGCTCAGGGCCGATGGATGGGAGGCGGTCCGGCCG
AACGGCATCGGACCGTACTTCAGGGAAATGGCGCGAAAAGAAGACGGTATCCCGTCGGAA
GCCGTGTCTAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003099 Prephenate dehydrogenase (Domain)
 [18-252]  6.09999999999996e-61 PF02153
PF02153   PDH
 [3-283]  PS51176
PS51176   PDH_ADH
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [166-274]  4.00000300869883e-22 SSF48179
SSF48179   6DGDH_C_like
IPR016040 NAD(P)-binding domain (Domain)
 [5-172]  4.6e-25 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-20]  0.645 Signal
Eukaryota   
 [1-20]  0.638 Signal
Bacteria, Gram-positive   
 [1-20]  0.685 Signal
Bacteria, Gram-negative   
TMHMM No significant hit