close all open/close all

CDS information : A4793_00250


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction56,388 / 57,497 / + [in whole cluster]
56,388 / 57,497 / + [in contig]
Location56388..57497 [in whole cluster]
56388..57497 [in contig]
TypeCDS
Length1,110 bp (369 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate synthase
Product (GenBank)HmaS
GenehmaS
ORF9
Gene (GenBank)
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
  • p-Hydroxymandelate synthetase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52791
NITE
Chlor_00220
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate synthase [HmaS]
MGTVMSELAMAADPLADLSVDYVEMYVENLEAAALTWVDKYAFTVVGSGDFADHRSTALR
HGRITLVLTEATSDEHVASTYVASHGDGVADIALRTADVTAAFDAAVANGARVHRPPTPH
GGDGPAVTAVLHGFGDVVHTLVQRAPGEEPGLPAGFSPISRTGDGPAGVDLLDLDHIAVC
LNTGDLDPTVDHYLTAFGFRRIFEERIVVGRQAMESAVVQSPSGSVTLTLIQPDPSADPG
QIDEFLKAHQGAGVQHLAFSSPDAVRSVRALADRGVTFLTTPQAYYDLLGERIALSESRV
DDLRATNVLVDEDHGGQLFQIFTASTHLRHTLFFEVIERQGAETFGSANIKALYEAVELE
RTGQRGPRQ
selected fasta
>putative 4-hydroxymandelate synthase [HmaS]
ATGGGGACAGTCATGAGCGAATTAGCAATGGCGGCGGATCCGCTGGCGGATCTCTCGGTC
GACTACGTAGAGATGTACGTGGAGAATCTGGAGGCGGCCGCACTCACCTGGGTCGACAAA
TACGCCTTCACGGTGGTCGGCTCCGGCGACTTCGCCGATCACCGAAGCACCGCACTGCGC
CACGGACGGATCACCCTGGTACTCACCGAAGCCACGTCGGACGAGCATGTGGCCTCGACC
TACGTCGCCTCACACGGCGACGGCGTCGCCGACATCGCCCTGCGCACCGCGGACGTGACC
GCCGCCTTCGACGCGGCGGTCGCGAACGGCGCCCGCGTCCACCGTCCGCCGACCCCGCAC
GGGGGGGACGGGCCGGCCGTGACGGCCGTCCTCCACGGCTTCGGCGACGTCGTCCACACA
CTCGTCCAGCGCGCTCCCGGGGAGGAGCCGGGGCTGCCCGCGGGCTTCTCACCGATATCG
CGGACCGGCGACGGCCCGGCGGGCGTGGACCTGCTCGACCTCGATCACATCGCGGTGTGC
CTGAACACCGGCGATCTCGACCCCACGGTCGACCACTACCTGACGGCGTTCGGGTTCCGG
CGCATCTTCGAGGAGCGCATCGTCGTCGGCAGGCAGGCCATGGAGTCCGCGGTGGTGCAG
AGCCCGTCGGGCTCGGTGACCCTGACGCTCATCCAGCCCGACCCCTCGGCCGACCCGGGA
CAGATCGACGAGTTCCTCAAGGCACACCAGGGGGCAGGCGTCCAGCATCTGGCCTTCTCC
TCCCCGGACGCGGTCCGTTCGGTGCGGGCCCTGGCCGACCGGGGCGTCACCTTCCTCACC
ACTCCTCAGGCCTACTACGACCTGCTGGGCGAGCGGATCGCCCTGAGCGAGTCCAGGGTG
GACGACCTCCGGGCGACGAACGTGCTCGTCGACGAGGACCACGGCGGCCAGCTCTTCCAG
ATCTTCACGGCGTCGACCCACCTGCGGCACACGCTGTTCTTCGAGGTCATCGAGCGCCAG
GGTGCCGAGACCTTCGGCAGTGCCAACATCAAGGCACTCTACGAGGCCGTGGAACTGGAG
AGGACGGGGCAGCGTGGGCCACGGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [21-123]  5.3e-05 PF00903 [174-321]  1.6e-15 PF00903
PF00903   Glyoxalase
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [19-363]  4.09999999999995e-107 TIGR01263
TIGR01263   4HPPD
 [8-368]  PIRSF009283
PIRSF009283   HPP_dOase
SignalP No significant hit
TMHMM No significant hit