close all open/close all

CDS information : A4793_00260


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction57,481 / 58,581 / + [in whole cluster]
57,481 / 58,581 / + [in contig]
Location57481..58581 [in whole cluster]
57481..58581 [in contig]
TypeCDS
Length1,101 bp (366 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate oxidase
Product (GenBank)Hmo
Genehmo
ORF8
Gene (GenBank)
EC number1.1.3.46
Keyword
  • Hpg
Note
Note (GenBank)
  • p-hydroxymandelate oxidase
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
O52792
NITE
Chlor_00230
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[12240298] Characterisation of a hydroxymandelate oxidase involved in the biosynthesis of two unusual amino acids occurring in the vancomycin group of antibiotics. (Chem Commun (Camb). , 2001)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate oxidase [Hmo]
MGHGSETAAAPAHCLADFERAAASVLPADVRDFVAGGSGAEVTLDANRTALDRVFLVPRV
LRDVSRCTADSTLLKRPVPMPVAVAPVAYQQLVHPDGERAAARAAKAAGVPFTASTLSSV
PIEELTAIGGTVWFQLYRLRDAAQSLELVRRAEDAGCEAIMLTVDVPWMGRRLRDVRNRF
ALPSHVRAANISTGSTAHRRHADSSAVAVHTGQAFSSATTWSSLAALRKQTRLPLLLKGV
LAAEDAVRAVESGVDAVVVSNHGGRQLDGAVPSIDVLPEVAAAVNDGCEVLLDSGIRSGT
DVLRALALGASGVLVGRPLIWGLAAAGEAGARRVLDLLADELRDALGLSGCDGVAAARQL
RTLVPG
selected fasta
>putative 4-hydroxymandelate oxidase [Hmo]
GTGGGCCACGGCAGTGAGACGGCGGCCGCTCCGGCCCACTGCCTGGCCGACTTCGAACGC
GCCGCCGCTTCGGTCCTGCCCGCCGACGTGCGGGACTTCGTCGCGGGAGGAAGCGGAGCC
GAGGTCACGCTCGACGCCAACCGCACCGCGCTGGACCGCGTCTTCCTCGTCCCCCGGGTG
CTCAGGGACGTGTCGCGGTGCACGGCTGACTCCACCCTGCTGAAGCGGCCCGTCCCGATG
CCGGTCGCCGTCGCGCCCGTCGCCTACCAGCAACTGGTCCACCCCGATGGCGAGAGGGCC
GCCGCCCGGGCGGCCAAGGCGGCCGGCGTGCCGTTCACCGCGAGCACGCTGAGCAGTGTC
CCGATCGAAGAGCTCACGGCGATCGGCGGAACGGTCTGGTTCCAGCTCTACCGGCTCCGG
GACGCCGCGCAGTCCCTGGAACTCGTCCGCAGAGCGGAGGACGCGGGCTGTGAGGCGATC
ATGCTCACCGTCGACGTGCCGTGGATGGGGCGCCGGCTGCGCGACGTACGCAACCGTTTC
GCCCTGCCCAGCCATGTGCGGGCGGCCAACATCAGCACCGGCTCGACCGCGCACCGACGG
CATGCCGACAGCTCCGCGGTAGCCGTCCACACGGGCCAGGCCTTCTCCTCCGCGACGACG
TGGTCGTCGTTGGCGGCCCTGCGGAAGCAGACCCGGCTCCCCCTGCTGCTCAAGGGTGTC
CTGGCGGCCGAGGACGCGGTGCGGGCGGTCGAGTCCGGGGTCGACGCGGTCGTGGTCTCC
AACCACGGGGGCCGCCAGCTTGACGGAGCCGTTCCCAGCATCGATGTGCTGCCGGAGGTG
GCCGCGGCCGTGAACGACGGCTGCGAAGTGCTGTTGGACAGCGGCATCCGCAGCGGCACC
GACGTGCTCAGGGCGCTCGCTCTCGGGGCGTCCGGTGTCCTGGTGGGCCGACCGCTGATC
TGGGGCCTGGCCGCGGCCGGAGAGGCCGGTGCCCGCCGGGTGCTCGACCTGCTGGCCGAC
GAACTCCGCGACGCCCTCGGCCTGTCGGGCTGCGACGGTGTCGCCGCGGCCAGGCAGTTG
CGCACCCTCGTCCCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000262 FMN-dependent dehydrogenase (Domain)
 [22-359]  5.20000000000001e-122 PF01070
PF01070   FMN_dh
IPR008259 FMN-dependent alpha-hydroxy acid dehydrogenase, active site (Active_site)
 [260-266]  PS00557
PS00557   FMN_HYDROXY_ACID_DH_1
IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent (Family)
 [1-365]  PIRSF000138
PIRSF000138   Al-hdrx_acd_dh
 [7-366]  PS51349
PS51349   FMN_HYDROXY_ACID_DH_2
IPR013785 Aldolase-type TIM barrel (Domain)
 [13-358]  1.29999999999998e-128 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit