close all open/close all

CDS information : A4793_00270


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction59,689 / 58,703 / - [in whole cluster]
59,689 / 58,703 / - [in contig]
Locationcomplement(58703..59689) [in whole cluster]
complement(58703..59689) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)StaQ
GenestaQ
ORF7
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • transcriptional regulator
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q7WZ87
NITE
A4092_00100
PmId
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
ACC
Q6ZZH8
NITE
Teicp2_00370
PmId
[22806031] Manipulating the regulatory genes for teicoplanin production in Actinoplanes teichomyceticus. (World J Microbiol Biotechnol. , 2012)
[24161919] Evaluation of heterologous promoters for genetic analysis of Actinoplanes teichomyceticus--Producer of teicoplanin, drug of last defense. (J Biotechnol. , 2013)
[25104028] The pathway-specific regulatory genes, tei15* and tei16*, are the master switches of teicoplanin production in Actinoplanes teichomyceticus. (Appl Microbiol Biotechnol. , 2014)

close this sectionSequence

selected fasta
>putative transcriptional regulator [StaQ]
MQREQEQIDRQTCVEVEISLLSTVDSPRTSGEDPDHVEALSVAQSPLPPILVHRPTMRVI
DGLHRVRAAELRGQDKIAVSFFEGSEADAFVLAVESNTMHGLPLSKADRKRAAARIVTSH
PQWSDRMVASVAGIAPGTVADIRRGLPGASAAEESRIGQDGRVRPINAAAGRRNAAKIIA
GNPGLSLRQIARMAGISPETARDVRSRLRRGEDPLPGRQSRTSADPGAKLPAPQRSAGDA
AVHGRPSGQDHSVVVERLKADPALRLSETGRTLLRLLNLHTIDATEWQRIIDNVPPHCSG
IVARLADEYAVMWSELALRLGGRVTETA
selected fasta
>putative transcriptional regulator [StaQ]
TTGCAGCGAGAGCAGGAACAGATCGATCGGCAGACCTGCGTCGAAGTGGAGATCAGCTTA
CTGTCAACAGTCGACTCACCGCGGACCTCGGGGGAGGATCCGGACCACGTGGAGGCGCTG
TCCGTCGCGCAGTCCCCGCTTCCTCCCATCCTCGTCCACCGTCCGACGATGCGCGTCATC
GATGGTCTCCATCGTGTGCGTGCGGCTGAACTGCGCGGCCAGGACAAGATCGCCGTCAGC
TTCTTCGAGGGCAGCGAGGCCGACGCGTTCGTGCTGGCGGTCGAGTCCAACACCATGCAC
GGACTCCCCTTGTCGAAGGCCGACCGCAAGCGGGCGGCGGCGCGGATCGTCACCTCGCAT
CCGCAGTGGTCGGACCGGATGGTCGCATCGGTCGCCGGTATTGCCCCCGGCACGGTGGCC
GACATACGCAGAGGGCTCCCGGGTGCGTCGGCCGCCGAGGAGAGCAGAATCGGCCAGGAC
GGCCGGGTCCGCCCGATCAACGCCGCCGCGGGACGCAGGAACGCGGCGAAGATCATCGCC
GGGAACCCCGGTCTCTCCTTACGCCAGATCGCCCGGATGGCCGGCATATCCCCCGAGACG
GCCCGCGATGTGAGAAGCCGGCTCCGCCGAGGAGAGGATCCGCTGCCCGGCCGGCAGAGC
AGGACATCGGCGGACCCCGGCGCGAAGCTCCCGGCGCCGCAGCGCTCTGCCGGCGACGCG
GCGGTGCACGGCAGGCCGTCGGGGCAGGATCACAGCGTCGTGGTGGAAAGGCTCAAGGCG
GATCCGGCCCTGCGGCTGAGCGAGACCGGACGCACACTGCTGCGGCTGCTCAACCTCCAC
ACGATCGATGCGACGGAGTGGCAGAGGATCATCGACAACGTACCGCCCCACTGCAGCGGC
ATCGTGGCACGTCTGGCCGACGAGTACGCGGTGATGTGGTCGGAGCTGGCCCTTCGGCTG
GGTGGCAGGGTCACCGAAACCGCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [14-98]  2.7e-08 SM00470
SM00470   ParB-like nuclease domain
 [14-97]  2.4e-08 PF02195
PF02195   ParBc
 [13-100]  5.7e-09 SSF110849
SSF110849   ParB/Sulfiredoxin
SignalP No significant hit
TMHMM No significant hit