close all open/close all

CDS information : A4793_00280


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction61,050 / 62,138 / + [in whole cluster]
61,050 / 62,138 / + [in contig]
Location61050..62138 [in whole cluster]
61050..62138 [in contig]
TypeCDS
Length1,089 bp (362 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productteicoplanin resistance protein
Product (GenBank)StaP
GenestaP
ORF6
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • putative membrane protein
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
[22232274] A novel membrane protein, VanJ, conferring resistance to teicoplanin. (Antimicrob Agents Chemother. , 2012)
Related Reference
ACC
Q9XAL0
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[22232274] A novel membrane protein, VanJ, conferring resistance to teicoplanin. (Antimicrob Agents Chemother. , 2012)

close this sectionSequence

selected fasta
>teicoplanin resistance protein [StaP]
MINEHLRSAVSKSERGQTMAEVDIAETVRGSQSADDEGHPSAGLSGPGPWRRGPVLTACA
LLLGLLLLLHGEVTDWAGLGSLVETFLPWFGLFIPVLVAGALWRRSASSAVALLLPVTVW
WSLFGGLPGGPTDQAGDLMVVSHNVAVENPDPAGTARDLAASGADLLALQELTDQTKASY
EKELAKTYPHYAEEGTVGLWSKLPLSGTRPVEPPVGKAQQDGIPVQPLRALRTTVATEEG
PLTVYVAHLGSVRVMPRGGFWTESRDADATKLAEAVAAERSKRVLVLGDFNGTLDDRAFD
GLTSQLRSSQDVAGDGFGFSWPAKFPVARIDQILVRGVEPTSAWLLPRTGSDHRPVAARI
SW
selected fasta
>teicoplanin resistance protein [StaP]
ATGATCAATGAGCACCTGCGATCAGCGGTGAGCAAGAGCGAGCGAGGACAGACGATGGCG
GAAGTGGACATCGCGGAGACCGTACGGGGCAGTCAGTCGGCCGACGACGAAGGACATCCG
TCCGCGGGTCTCTCCGGTCCGGGCCCGTGGAGGCGCGGCCCGGTACTCACGGCGTGTGCG
CTGCTGCTCGGCCTGCTTCTGCTGCTGCACGGGGAGGTCACGGACTGGGCCGGTCTGGGC
AGTCTGGTGGAGACCTTCCTGCCGTGGTTCGGTCTGTTCATCCCGGTTCTGGTTGCCGGA
GCGCTGTGGCGCCGCTCCGCCTCGTCGGCCGTCGCCCTGCTATTGCCGGTCACCGTGTGG
TGGAGCCTCTTCGGCGGGCTGCCCGGCGGCCCGACCGACCAGGCCGGCGATCTCATGGTG
GTCAGCCACAACGTGGCCGTCGAGAACCCTGATCCAGCCGGCACCGCCCGTGACCTGGCC
GCCTCCGGCGCGGACCTGCTGGCGCTCCAGGAACTGACCGACCAGACCAAGGCCAGCTAC
GAGAAGGAGCTGGCGAAGACGTACCCGCACTACGCCGAGGAGGGCACGGTCGGGCTCTGG
AGCAAGCTGCCGCTGTCCGGCACCCGGCCGGTCGAGCCGCCGGTCGGGAAAGCGCAGCAG
GATGGCATCCCGGTGCAACCGCTTCGGGCGCTGCGCACCACGGTGGCCACCGAGGAGGGG
CCGCTGACGGTGTACGTGGCGCATCTCGGTTCCGTGAGGGTGATGCCCAGGGGCGGTTTC
TGGACGGAATCGCGGGACGCCGACGCGACGAAGCTCGCCGAGGCCGTCGCCGCCGAGCGC
AGCAAGCGGGTGCTGGTGCTCGGTGACTTCAACGGCACCCTGGACGACCGTGCGTTCGAC
GGCCTCACCTCGCAGCTGCGTTCGTCCCAGGACGTGGCGGGGGACGGGTTCGGCTTCAGC
TGGCCGGCGAAGTTCCCGGTGGCACGGATCGACCAGATCCTGGTCCGCGGCGTGGAGCCG
ACGAGTGCGTGGCTGCTGCCGCGCACGGGCAGTGACCACCGTCCGGTGGCGGCCCGAATC
AGCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005135 Endonuclease/exonuclease/phosphatase (Domain)
 [136-362]  7.3e-26 SSF56219
SSF56219   DNase I-like
 [142-353]  2.7e-17 PF03372
PF03372   Exo_endo_phos
SignalP No significant hit
TMHMM
 [54-71]  Transmembrane (i-o) [86-103]  Transmembrane (o-i) [110-132]  Transmembrane (i-o)
Transmembrane 3