close all open/close all

CDS information : A4793_00290


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction62,227 / 63,393 / + [in whole cluster]
62,227 / 63,393 / + [in contig]
Location62227..63393 [in whole cluster]
62227..63393 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative glycyltransferase
Product (GenBank)StaO
GenestaO
vanK
ORF5
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • FemABX homolog
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q9XAK9
PmId
[15130128] Characterization of an inducible vancomycin resistance system in Streptomyces coelicolor reveals a novel gene (vanK) required for drug resistance. (Mol Microbiol. , 2004)
[15632111] The role of the novel Fem protein VanK in vancomycin resistance in Streptomyces coelicolor. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>putative glycyltransferase [StaO]
MSNNSSRALTRTAAGNPVVRPISAADHLAFVRAQRSVSFLQTPAWGRVKTEWRSESLGWF
DGPRLVGAGLVLHRPVPRLDRYTLAYLPEGPVIDWSSEIGAWLDPLAAYLKEHGAFAIRL
GPPVVTDTWDATQIKDGIADPQIRRLTDMPGRWDDPVGARVSSQLKDAGWLPQNPLDGFG
VGHPQFKYVLPLAGRTEDELLRGMNQQWRRNIKKSAKEGVEVTVSDGGPEDLKAFHDLYV
HTAERDRFTPRPLSYFETMFTALRAEDPERIKIYLAHHQGDLVAATVMVRVGSHAVYSYG
ASATAKREVRGSNACQWAMIRDALAADCDVYDLRGITPTLDADDPHVGLVRFKVGTGGQA
VRYVGEWDLPLRPMIYRAFDLYMRRRGH
selected fasta
>putative glycyltransferase [StaO]
ATGTCCAACAATTCCTCCCGCGCACTCACACGAACCGCAGCCGGAAATCCGGTCGTCAGG
CCGATCAGCGCCGCCGATCACTTGGCGTTCGTCCGGGCCCAGCGGTCGGTCAGCTTCCTG
CAGACCCCGGCGTGGGGCCGGGTCAAGACCGAGTGGCGCAGCGAGTCCCTCGGCTGGTTC
GACGGTCCGCGCCTGGTGGGTGCCGGGCTCGTTCTGCACCGCCCGGTACCGCGGCTCGAC
CGGTACACCCTGGCGTATCTGCCCGAGGGCCCGGTCATCGACTGGAGCAGCGAGATCGGT
GCGTGGCTCGATCCGCTGGCGGCATATCTCAAGGAGCACGGCGCGTTCGCGATCCGGCTC
GGTCCGCCGGTGGTCACGGACACCTGGGACGCCACCCAGATCAAGGACGGCATCGCCGAC
CCGCAGATCCGGCGGCTGACCGACATGCCAGGACGGTGGGACGACCCGGTCGGCGCCCGT
GTGAGCAGCCAGCTCAAGGACGCGGGCTGGCTGCCGCAGAACCCGCTGGACGGGTTCGGG
GTCGGGCATCCGCAGTTCAAGTACGTTCTCCCGTTGGCGGGCAGGACCGAGGACGAGCTG
CTGAGAGGCATGAACCAGCAGTGGCGCCGCAACATCAAGAAGTCGGCCAAGGAGGGCGTC
GAGGTCACGGTCAGCGACGGGGGTCCGGAGGACCTGAAGGCGTTTCACGACCTCTACGTC
CACACCGCCGAGCGCGACCGCTTCACACCCCGCCCGCTGAGCTACTTCGAGACCATGTTC
ACGGCACTGCGCGCCGAGGACCCCGAGCGGATCAAGATCTACCTGGCCCACCACCAGGGC
GACCTGGTCGCGGCCACCGTCATGGTCCGCGTCGGATCCCACGCGGTGTACTCCTACGGC
GCCTCCGCCACCGCGAAGCGCGAGGTGCGCGGCTCCAACGCCTGCCAGTGGGCGATGATC
CGTGACGCACTCGCGGCCGACTGCGACGTCTACGACCTGCGCGGCATCACCCCGACCCTC
GACGCCGACGACCCACACGTCGGCCTTGTCCGGTTCAAGGTCGGCACCGGTGGCCAGGCG
GTGCGGTACGTCGGCGAGTGGGACCTGCCGCTGCGGCCGATGATCTACCGGGCCTTCGAC
CTCTACATGAGGCGCCGCGGGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003447 Methicillin resistance protein (Family)
 [22-276]  1.9e-36 PF02388 [281-380]  4.80000000000001e-26 PF02388
PF02388   FemAB
 [17-382]  PS51191
PS51191   FEMABX
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [20-129]  6.40000000000004e-34 G3DSA:3.40.630.30 [161-198]  6.40000000000004e-34 G3DSA:3.40.630.30 [199-359]  4.30000000000003e-53 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [17-194]  7.90003079443025e-34 SSF55729 [195-382]  1.10000150671643e-44 SSF55729
SSF55729   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit