close all open/close all

CDS information : A4793_00300


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction64,746 / 63,406 / - [in whole cluster]
64,746 / 63,406 / - [in contig]
Locationcomplement(63406..64746) [in whole cluster]
complement(63406..64746) [in contig]
TypeCDS
Length1,341 bp (446 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-lactate ligase
Product (GenBank)MurX
GenemurX
ORF4
Gene (GenBank)murX
EC number
Keyword
Note
Note (GenBank)
  • D-alanine:D-alanine adding enzyme; similar to E. coli MurF protein, a D-alanine:D-alanine adding enzyme; similar to E. coli MurF protein
Reference
ACC
PmId
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q70B07
NITE
Teicp2_00100
PmId
[15500981] Glycopeptide resistance determinants from the teicoplanin producer Actinoplanes teichomyceticus. (FEMS Microbiol Lett. , 2004)

close this sectionSequence

selected fasta
>putative UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-lactate ligase [MurX]
MIPLGLGEIAEIVGGKATGESVTVTAPAVLDSRQAEPGGLFVAFAGEHADGHDYAERAGR
AGAVAVLGSRPTSLPTVVVEDVRTALQTLAAHVVARLRDGLTVVGVTGSQGKTGTKDLLA
AVLSGAGPTVATTGSLNNELGVPLTMLRAQAATRFLVLEMGARHEGDIAELTGLVAPDIA
VVLNVGVAHLGEFGSRAAIARAKGELVQGLVPGGTAVLNADDPRVASMSVLTDGPVLTFG
RTDPADVQVLDVVLDRLGRPSCTLRTVDTSARLALPLVGAHQALNASAAAAAALAAGVPL
DLATTALTTASLSPWRMELRDLACGATLLNDSYNANPDSTRAALDALSAIEGGRRIAVLG
EMLELGDGSEAEHRAVGAYAAARADVVVAVGEAARPLADGAGERAVVLAGNDAAVDWLRD
HLAAGDVVLVKASRGARLDEVAAGLA
selected fasta
>putative UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-lactate ligase [MurX]
GTGATTCCGCTCGGGCTCGGCGAGATCGCCGAAATCGTTGGCGGAAAGGCCACGGGCGAA
TCCGTGACCGTGACCGCGCCGGCCGTGCTCGACAGCCGACAGGCCGAGCCGGGCGGCCTC
TTCGTCGCCTTCGCCGGCGAGCATGCCGACGGCCATGACTACGCCGAGCGGGCCGGGCGG
GCCGGTGCGGTGGCCGTGCTCGGCTCCCGGCCCACGTCGCTGCCCACCGTCGTCGTCGAG
GACGTCCGGACCGCGCTGCAGACGCTCGCCGCCCATGTCGTGGCCCGGCTGCGCGACGGG
CTGACCGTCGTCGGGGTGACCGGTTCGCAGGGCAAGACCGGCACCAAGGACCTGCTGGCG
GCCGTGCTGTCGGGCGCCGGGCCGACGGTCGCCACGACCGGCTCGCTCAACAACGAACTC
GGTGTGCCGCTCACCATGCTGCGCGCCCAGGCGGCCACCCGGTTCCTCGTCCTGGAGATG
GGAGCCCGCCACGAGGGCGACATCGCCGAGCTCACCGGCCTGGTCGCACCCGACATCGCC
GTCGTGCTCAACGTCGGCGTGGCCCACCTCGGCGAGTTCGGGTCGCGTGCCGCCATCGCC
AGGGCCAAGGGCGAACTGGTGCAGGGCCTTGTGCCCGGCGGCACCGCCGTGCTCAACGCC
GACGATCCGAGGGTGGCCTCGATGAGCGTGCTCACCGACGGTCCGGTTCTGACCTTCGGC
CGGACGGACCCGGCCGACGTACAGGTACTCGACGTGGTCCTCGACCGACTCGGCCGGCCG
TCCTGCACGCTGAGGACCGTCGACACCTCGGCTCGCCTCGCGCTGCCGCTCGTCGGTGCC
CACCAGGCGCTCAACGCCTCGGCCGCCGCGGCGGCGGCACTCGCGGCCGGGGTTCCCCTC
GACCTGGCCACGACGGCGCTGACCACCGCCTCGCTGTCGCCGTGGCGGATGGAACTGCGC
GACCTCGCCTGCGGGGCGACGCTGCTCAACGACTCCTACAACGCCAACCCCGACTCGACC
CGCGCCGCTCTGGACGCGCTGTCGGCCATCGAGGGCGGGCGCCGCATCGCCGTACTCGGC
GAAATGCTCGAACTCGGCGACGGGAGCGAGGCGGAGCACCGTGCCGTCGGGGCGTACGCC
GCCGCCCGGGCCGACGTGGTGGTGGCCGTCGGCGAGGCCGCCCGGCCCCTCGCCGACGGT
GCTGGAGAGCGGGCCGTGGTCCTCGCCGGCAACGACGCGGCCGTCGACTGGCTGCGCGAC
CACCTGGCCGCCGGGGATGTGGTGCTGGTCAAGGCTTCCCGTGGGGCGCGCCTCGACGAA
GTCGCCGCCGGACTCGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000713 Mur ligase, N-terminal (Domain)
 [30-92]  3.2e-12 PF01225
PF01225   Mur_ligase
IPR004101 Mur ligase, C-terminal (Domain)
 [313-446]  2.1000026783403e-39 SSF53244
SSF53244   Mur_ligase_C
 [314-445]  4.30000000000003e-43 G3DSA:3.90.190.20
G3DSA:3.90.190.20   Mur_ligase_C
 [316-394]  5.29999999999999e-16 PF02875
PF02875   Mur_ligase_C
IPR005863 UDP-MurNAc-pentapeptide synthetase (Family)
 [30-443]  9.2000000000001e-123 TIGR01143
TIGR01143   MurF
IPR013221 Mur ligase, central (Domain)
 [100-311]  3.70001063537244e-53 SSF53623
SSF53623   Mur_ligase_cen
 [106-293]  5.49999999999995e-40 PF08245
PF08245   Mur_ligase_M
 [87-308]  9.69999999999989e-62 G3DSA:3.40.1190.10
G3DSA:3.40.1190.10   Mur_ligase_cen
SignalP No significant hit
TMHMM No significant hit