close all open/close all

CDS information : A4793_00320


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction65,854 / 66,894 / + [in whole cluster]
65,854 / 66,894 / + [in contig]
Location65854..66894 [in whole cluster]
65854..66894 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductD-alanine--D-lactate ligase
Product (GenBank)D-alanine:D-alanine ligase-related protein
GenevanAst
ddlM
ORF2
Gene (GenBank)DdlM
EC number6.1.2.1
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9177243] D-Ala-D-Ala ligases from glycopeptide antibiotic-producing organisms are highly homologous to the enterococcal vancomycin-resistance ligases VanA and VanB. (Proc Natl Acad Sci U S A. , 1997)
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q9S611
PmId
[9791137] DdlN from vancomycin-producing Amycolatopsis orientalis C329.2 is a VanA homologue with D-alanyl-D-lactate ligase activity. (J Bacteriol. , 1998)
ACC
P25051
PmId
[1998664] Identification of vancomycin resistance protein VanA as a D-alanine:D-alanine ligase of altered substrate specificity. (Biochemistry. , 1991)
[1931965] Molecular basis for vancomycin resistance in Enterococcus faecium BM4147: biosynthesis of a depsipeptide peptidoglycan precursor by vancomycin resistance proteins VanH and VanA. (Biochemistry. , 1991)
[1522072] The cytoplasmic peptidoglycan precursor of vancomycin-resistant Enterococcus faecalis terminates in lactate. (J Bacteriol. , 1992)
[10908650] The molecular basis of vancomycin resistance in clinically relevant Enterococci: crystal structure of D-alanyl-D-lactate ligase (VanA). (Proc Natl Acad Sci U S A. , 2000)
ACC
Q06893
PmId
[7957913] Purification and characterization of the VanB ligase associated with type B vancomycin resistance in Enterococcus faecalis V583. (FEBS Lett. , 1994)

close this sectionSequence

selected fasta
>D-alanine--D-lactate ligase [D-alanine:D-alanine ligase-related protein]
MARLKIGIVFGGRSEEHPVSIKSAREVARNLDLEKYEPFYIGITKSGAWKLCDGPDAEWE
DGDCRPVVLSPDSDVHGLLVLEQGGCSTIRLDVVLPVLHGKLGEDGAMQGLLELSGIPYV
GCDIQSSAVCMDKSLAYAVVRNAGIATPNFWTVAADETVDAARFTYPVFVKPARSGSSFG
VTKVSREEEMSSAVETARQYDSKVLIEEAVPGSEIGCAILGTGTDLVVGEVDRIALSHGF
FRIHQEDSPETGSENSIAIVPADIPEASRLRVQEEAKAVYRVLGCRGIARVDMFLKEDGE
VVLNEVNTLPGLTSYSRYPRMMAAAGLPMSEVIDLTVSLALTGKMR
selected fasta
>D-alanine--D-lactate ligase [D-alanine:D-alanine ligase-related protein]
ATGGCCAGACTGAAGATCGGCATCGTATTCGGAGGCCGTTCCGAGGAGCACCCCGTCTCC
ATCAAGTCCGCGCGGGAGGTGGCCCGGAACCTGGATCTCGAAAAGTACGAACCCTTCTAC
ATCGGGATCACGAAGAGCGGTGCCTGGAAGCTCTGCGACGGGCCCGACGCGGAATGGGAG
GACGGCGACTGCCGCCCGGTCGTGCTGTCGCCGGACAGCGACGTGCACGGACTGCTGGTG
CTGGAGCAGGGAGGCTGCAGCACGATCCGTCTGGACGTCGTACTGCCCGTGCTGCACGGC
AAACTCGGCGAGGACGGCGCGATGCAGGGTCTGCTGGAACTCTCGGGCATCCCCTACGTC
GGCTGCGACATCCAGAGTTCCGCCGTGTGCATGGACAAGTCCCTTGCCTATGCGGTCGTC
AGGAACGCGGGAATCGCCACGCCGAACTTCTGGACCGTCGCGGCGGACGAGACCGTCGAT
GCCGCCCGGTTCACCTATCCGGTCTTCGTGAAGCCGGCCCGATCGGGGTCGTCCTTCGGC
GTCACCAAGGTGTCCCGGGAGGAGGAGATGTCGAGTGCCGTGGAAACGGCACGGCAGTAC
GACTCGAAGGTGCTGATCGAAGAGGCCGTCCCCGGCAGCGAGATCGGCTGCGCCATCCTG
GGGACCGGAACGGATCTCGTCGTGGGCGAGGTGGACCGGATCGCGCTCTCGCACGGATTC
TTCAGGATCCATCAGGAGGACTCCCCCGAGACCGGGTCCGAGAACTCCATCGCGATCGTT
CCCGCCGACATCCCCGAAGCGTCACGGCTGCGCGTCCAGGAGGAGGCCAAGGCCGTGTAC
CGCGTCCTGGGATGCCGCGGCATTGCTCGGGTGGACATGTTCCTCAAGGAGGACGGCGAA
GTCGTCCTCAACGAGGTCAACACCCTCCCCGGATTGACCTCGTACAGCCGTTATCCGCGG
ATGATGGCGGCCGCGGGTCTGCCGATGTCCGAAGTGATCGACCTCACCGTCTCCCTCGCT
CTGACAGGGAAGATGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000291 D-alanine--D-alanine ligase/VANA/B/C, conserved site (Conserved_site)
 [99-110]  PS00843
PS00843   DALA_DALA_LIGASE_1
 [283-311]  PS00844
PS00844   DALA_DALA_LIGASE_2
IPR005905 D-alanine--D-alanine ligase (Family)
 [5-340]  3.90000000000001e-85 TIGR01205
TIGR01205   D_ala_D_alaTIGR
IPR011095 D-alanine--D-alanine ligase, C-terminal (Domain)
 [139-337]  4.89999999999996e-71 PF07478
PF07478   Dala_Dala_lig_C
IPR011127 D-alanine--D-alanine ligase, N-terminal (Domain)
 [5-122]  6.70000000000001e-32 PF01820
PF01820   Dala_Dala_lig_N
IPR011761 ATP-grasp fold (Domain)
 [137-338]  PS50975
PS50975   ATP_GRASP
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [136-210]  1.69999999999999e-27 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [122-135]  6e-36 G3DSA:3.30.470.20 [212-341]  6e-36 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
IPR016185 Pre-ATP-grasp fold (Domain)
 [1-121]  4.10000000000004e-35 G3DSA:3.40.50.20
G3DSA:3.40.50.20   Pre-ATP_grasp
 [2-131]  1.70000295590053e-39 SSF52440
SSF52440   PreATP-grasp-like
SignalP No significant hit
TMHMM No significant hit