close all open/close all

CDS information : A4793_00330


close this sectionLocation

Organism
StrainNRRL 15009
Entry nameA47934
Contig
Start / Stop / Direction66,891 / 67,517 / + [in whole cluster]
66,891 / 67,517 / + [in contig]
Location66891..67517 [in whole cluster]
66891..67517 [in contig]
TypeCDS
Length627 bp (208 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
ProductD-alanyl-D-alanine dipeptidase
Product (GenBank)D-ala-D-ala dipeptidase
GenevanXst
ORF1
Gene (GenBank)vanXst
EC number3.4.13.22
Keyword
Note
Note (GenBank)
  • VanXst
Reference
ACC
PmId
[9751644] Homologs of the vancomycin resistance D-Ala-D-Ala dipeptidase VanX in Streptomyces toyocaensis, Escherichia coli and Synechocystis: attributes of catalytic efficiency, stereoselectivity and regulation with implications for function. (Chem Biol. , 1998)
[12060705] Assembling the glycopeptide antibiotic scaffold: The biosynthesis of A47934 from Streptomyces toyocaensis NRRL15009. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q6ZZK1
NITE
Teicp2_00130
PmId
[17220405] Resistance to glycopeptide antibiotics in the teicoplanin producer is mediated by van gene homologue expression directing the synthesis of a modified cell wall peptidoglycan. (Antimicrob Agents Chemother. , 2007)

close this sectionSequence

selected fasta
>D-alanyl-D-alanine dipeptidase [D-ala-D-ala dipeptidase]
MKPTESMTDGFVFADDLVPGLRWDAKYATWDNFTGKPVDGYLVNRIVGTKALCAALERAR
DEAASLGFGLLLWDGYRPQRAVDCFLRWSQQPEDGRTKSRHYPNIARAEMFEKGYVAARS
GHSRGSTVDLTLYDLATNELVPMGGDHDLMDPVSHHGAQGLAPVEARNRQHLRSVMESCG
FKAYEYEWWHYTLADEPYPDTYFDFPIM
selected fasta
>D-alanyl-D-alanine dipeptidase [D-ala-D-ala dipeptidase]
ATGAAGCCGACGGAGTCCATGACGGACGGCTTCGTCTTCGCGGACGACTTGGTGCCCGGA
CTGCGCTGGGACGCCAAGTACGCCACGTGGGACAACTTCACCGGCAAACCTGTGGACGGA
TATCTGGTCAACCGAATCGTCGGTACGAAGGCTCTGTGCGCGGCTCTGGAGCGGGCGCGG
GACGAGGCCGCGTCACTGGGGTTCGGCCTGCTGCTCTGGGACGGCTATCGACCGCAGCGC
GCCGTCGACTGCTTTCTGCGCTGGTCGCAGCAGCCGGAGGACGGCCGGACGAAGTCGCGG
CACTATCCCAACATCGCCAGGGCCGAGATGTTCGAGAAGGGATATGTGGCCGCCAGGTCG
GGCCACAGCAGGGGCAGCACCGTCGACCTCACACTCTACGACCTGGCCACGAACGAGCTC
GTTCCCATGGGCGGCGACCACGACCTGATGGATCCCGTCTCGCACCACGGGGCACAAGGG
CTCGCCCCCGTCGAGGCGCGGAACCGTCAGCACCTGCGGTCCGTGATGGAGTCCTGCGGT
TTCAAGGCGTACGAGTACGAGTGGTGGCACTACACGCTCGCCGACGAGCCCTATCCGGAC
ACGTACTTCGATTTCCCCATCATGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000755 Peptidase M15D, VanX D-ala-D-ala dipeptidase (Family)
 [8-206]  1.10000000000001e-68 PF01427
PF01427   Peptidase_M15
 [1-208]  4.10001399699315e-59 PIRSF026671
PIRSF026671   AA_dipeptidase
IPR009045 Hedgehog signalling/DD-peptidase zinc-binding domain (Domain)
 [8-207]  6.10000000000004e-65 G3DSA:3.30.1380.10
G3DSA:3.30.1380.10   Hedgehog/DD-pept_Zn-bd
 [7-208]  4.69998262513189e-72 SSF55166
SSF55166   Hedgehog_sig_N
SignalP No significant hit
TMHMM No significant hit